KEGG   Solanum tuberosum (potato): 102580415Help
Entry
102580415         CDS       T02981                                 

Definition
(RefSeq) putrescine N-methyltransferase 2-like
  KO
K05353  putrescine N-methyltransferase [EC:2.1.1.53]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00960  Tropane, piperidine and pyridine alkaloid biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    102580415
Enzymes [BR:sot01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.53  putrescine N-methyltransferase
     102580415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_30 Methyltransf_24
Motif
Other DBs
NCBI-GeneID: 102580415
NCBI-ProteinID: XP_015165786
Position
Un
AA seq 322 aa AA seqDB search
MEVISTHTNSFVITITINDHHNNSKSNHRNGGTTHDNGNKLLLGNSNSIKPGWFSEFSAL
WPGEAFSVKIENLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLP
LGSIPSPKKVLIIGVGIGFTLFEVLRYPTIEKIDIVEIDDVVVDVSRKFFPYLAANFNDP
RATLVLGDGTAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCTQ
AESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPVN
PIDKDITHVKSNLEPLKFYNTD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcatatctactcacacaaatagctttgtcatcacaatcaccatcaacgaccac
cacaataatagcaagtccaatcaccgaaacggcggaacaactcatgacaatggcaataag
ctattattgggaaactccaactctattaagcctggttggttttcagagttcagcgcgtta
tggccaggtgaagcattctcagtaaaaattgagaatttgttatttcaagggaagtcagat
tatcaagatgtcatgctctttgagtcagcaacttatggtaaggttcttacattggatgga
gcaattcaacacacagaaaatggtggatttccatatactgaaatgattgttcatctacca
cttggttcaatcccaagtcccaaaaaggtgttgatcattggtgtaggaattggttttaca
ttattcgaagttcttcgttatcctaccatagaaaaaatagatattgttgagattgatgat
gtggtggtcgatgtgtctagaaaatttttcccctaccttgcggctaattttaatgatcct
cgtgcaactcttgttctcggcgatggaactgcatttgtaaaggctgcacaagcagggtat
tatgatgctattatagtggactcttctgatcctattggtccagcaaaagatttatttgag
aggccattttttgaggcagtagccaaagctcttaggccaggaggagttgtatgcacgcag
gctgaaagtatttggcttcatatgcatattattaaacaaattattgctaattgtcgtcaa
gtctttaaaggttctgttaactatgcttggactactgttccaacgtatcccactggtgta
attggttacatgctttgctctactgagggaccagaagttgactttaagaatccagttaat
ccgattgacaaagatataacccatgtcaagtcaaacttagaacctctcaagttctacaac
actgat

DBGET integrated database retrieval system