KEGG   Solanum tuberosum (potato): 102581214Help
Entry
102581214         CDS       T02981                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 3
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00430  Taurine and hypotaurine metabolism
sot00460  Cyanoamino acid metabolism
sot00480  Glutathione metabolism
sot00590  Arachidonic acid metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102581214
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102581214
   00460 Cyanoamino acid metabolism
    102581214
   00480 Glutathione metabolism
    102581214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sot01002]
    102581214
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sot04090]
    102581214
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     102581214
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     102581214
    3.4.19.14  leukotriene-C4 hydrolase
     102581214
Peptidases and inhibitors [BR:sot01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   102581214
CD molecules [BR:sot04090]
 Proteins
  102581214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 102581214
NCBI-ProteinID: XP_006353508
UniProt: M0ZHA9
Position
Un
AA seq 630 aa AA seqDB search
MGKHILEGPLLDSSPPLGSNRKKKWSLSLCFLFAFIAITFVGLTHHGDIGVWLIGDVNSS
RYNERLQQNADVVESEEAVVAADDGRCSKIGISMLKIGGHAVDAAVATALCLGVVNPMAS
GIGGGGFMVVRSSSTSEVLAIDMRETAPLAASQNMYDNNGDSKLNGALSMGVPGELAGLH
TAWSKNGRLPWKTLFQPAIKLAREGFVVAPYLGSSIAKNAKLLLKDPGLRQVFAPEGKPL
RAGEICHNIELSHSLELIAEQGPEAFYNGEVGEKLVEDVKRAGGILTMDDLRSYRVETPE
AVTVNAMGYTIVGMPPPSSGTLGISLILKVLENYVSSNAVKGSLGLHRMIEAMKHMLAVR
MNLGDPAFVNISSTVSDMLSPSFAKELQRKIFDNTTFPPEYYLPRFGQLRDHGTSHFCIV
DADRNAVSVTTTVNYPFGGGVLSPSTGIVLNNEMGDFSTPNEISPDKLPPAPANFIRPKK
RPLSSMTPVIVLKDNQLAGVIGGSGGLKIIFAVVQVFINHFVLGMDPLAAVQSPRVYHEL
IPNVVLYENWTCIDGDHIELSDDKKHFLEERGHQLEARSGGAICQLIVQNLPNPPLQLGR
RSGKQYKDGIFRGLLVAVSDPRKDGRPAAI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggggaaacatattttagaaggtccacttttggactcttctcctcctcttggttctaat
agaaagaaaaaatggagtctttctctttgctttttatttgcattcattgccataacattt
gttgggcttacacatcatggagacattggtgtatggctaattggagatgtaaatagtagc
agatataatgaaagactacagcaaaatgctgatgttgttgaatcagaggaagcagttgtt
gctgctgatgatggtcggtgctcgaaaatcggtatttccatgcttaaaattggtggacat
gcagttgatgctgcagttgccacagcactgtgtctaggagtagtcaatccaatggctagt
ggaattggcggtggcggttttatggttgttagatcttcatctacatcagaagtcttagca
attgacatgagggaaactgctcctttagctgcttcacagaacatgtatgataataatggg
gactccaagttaaatggagcattgtctatgggagttcctggtgagttagctggtcttcac
acagcttggtcgaaaaatgggaggttgccctggaagaccctatttcaaccggccattaaa
cttgcaagggagggattcgtggttgctccatatctcggaagctctattgctaaaaatgca
aaattgctacttaaagatcctggcttgcgacaagtatttgcacctgagggaaagccgtta
cgagcaggtgaaatttgtcataacatagaacttagccacagcttagagctaattgctgaa
caagggccggaagcattttataatggagaggttggtgaaaagcttgtcgaagatgtgaag
agagcaggtggaattttgacgatggacgacttaaggagttaccgagtggaaactccagaa
gcagttactgttaatgctatgggctatacaatcgttggaatgccacctccgtccagtgga
acactcgggatttctctgatacttaaagtccttgaaaactatgtgagttcaaatgctgtg
aaaggttctttaggactgcatcgaatgattgaggcgatgaaacacatgcttgcagttcga
atgaaccttggtgatcccgcctttgtaaatatcagcagtaccgtatctgacatgctttcc
ccgtcttttgccaaagaacttcaacgaaagatctttgacaataccacctttcctcctgaa
tactatttgcccaggtttggtcagctaagagatcatggaacgagtcacttctgcattgtg
gatgcagatcgaaatgctgtatcagtgacaaccacagtaaactatccatttggaggcggt
gtgctctctccatcaaccggtatagtactcaacaatgaaatgggagatttctcaactcct
aatgaaatatccccagataaactccctcctgctcctgctaattttattcgaccaaaaaag
agaccgttatcatccatgactccagttatcgttctcaaggacaatcaattagctggtgta
atcggtggtagtggtggcctaaaaatcatctttgcagtcgtccaagttttcatcaaccat
ttcgtgttagggatggatcctttagctgcagtacagagtccgagagtctaccacgagcta
atcccaaatgttgttctgtatgagaactggacatgcatagatggtgatcacattgaactc
tcggatgataaaaagcatttcttagaagagaggggtcatcaactcgaggcaagaagcgga
ggagccatctgtcagttaatcgttcaaaaccttccaaatcctccgttacagttgggcaga
aggagtggaaaacaatataaagacggtatttttcgtggtctgcttgtggctgttagtgat
cctaggaaagatggaagacctgcagccatctga

DBGET integrated database retrieval system