KEGG   Solanum tuberosum (potato): 102584355Help
Entry
102584355         CDS       T02981                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00052  Galactose metabolism
sot00500  Starch and sucrose metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102584355
   00500 Starch and sucrose metabolism
    102584355
Enzymes [BR:sot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102584355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 102584355
NCBI-ProteinID: XP_006342970
UniProt: M0ZRR7
Position
Un
AA seq 571 aa AA seqDB search
MGYASSVWLGVLVFISIHGYGNIRLFEASSRVIQTPDQIYRTGYHFQPAKYWMNDPNGPM
IYMGIYHFFYQYNPYDAQAGNIVWGHSTSTDLVNWTPQPPALLRSEPYDFKGCFSGSTTL
LSGGKPAILYTGVDFSDNQVQNLAVPKNLADPYLTEWVKSPYNPLIAPNSVNKIDGQNFR
DPTTAWLNPDGNWRMVVGNQQDGNGIGLLYRSKNFIDWIQAENPLHFMNYSGMWECPDFF
PVSTISQNGLETSTMGPNVKHVFKASKASTDFYTVGTYNPNKDIFIPDNKSLDIGLGFRY
DYGKFYASKSFFESSTSRRILFGWVNESVNNLEMNSIRGWAGLQGIPRRIWLHKSGNQLL
QWPIVEIEKLRMNPVIEDTSVLMPGSIREISGVNATQADIEMSFSAKTLEKAEKWEANWT
NPQQVCSTKGASVKGGIGPFGLLVLASKDMQEYTAIFFRIFRGDNNNFIVLMCSDQTRSS
LHLPSSDYDKTTYGALLNVDPLQEKLSLRTLIDHSIVESFGGEGKACITARVYPTNLAVD
GATHLYVFNNGSQSVDISKLTAWSMKTAQIN
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgggatatgctagtagtgtttggcttggagttttggtattcatttcaattcatggctat
ggcaatattagactatttgaggcttcttctcgtgtcatacagacacccgatcagatatac
cgcactggttatcattttcaacctgccaagtattggatgaacgatcctaatggaccaatg
atatacatggggatttaccatttcttctatcagtacaatccttacgatgcacaagcaggt
aacatagtatggggccattccacatcgaccgatctcgtcaactggacgcctcagccgccg
gcgcttctccgatcagagccttacgatttcaaaggctgtttttccggttctacaactctt
ctctccggcggaaaaccggcgattctctacaccggcgtagatttctccgataaccaggta
caaaatctagcagtccccaaaaatttagctgacccgtaccttaccgaatgggtaaaatcg
ccttacaatccattaatcgcaccgaattcggtaaacaaaattgatggacaaaatttcaga
gatccaactactgcttggctaaatcctgacggaaattggagaatggtagttggaaatcaa
caagacggaaacggaattggcttattgtatagaagcaaaaacttcattgattggattcaa
gctgaaaatccactgcattttatgaactattctggaatgtgggaatgccctgattttttc
cctgtttcaacaatcagtcaaaatggtctagaaacttctacaatgggtccaaatgtgaaa
catgtattcaaggcaagtaaagcaagcactgatttctacacagttggtacatataatccg
aataaagatatttttatcccggataacaaatcacttgatattggattaggatttcgttac
gattatggtaaattttatgcatcgaaaagttttttcgagagttctactagtaggaggatt
ttgtttggatgggttaatgaatcagtaaataatcttgagatgaatagtattagaggatgg
gctggtcttcaaggaattcctagaaggatttggcttcataaatctggaaatcagctgctt
caatggccgatagttgaaattgaaaagcttcgaatgaatccagttattgaagatacttct
gtgcttatgccaggatccatacgtgaaatttctggagtcaatgctacgcaggcagatata
gaaatgtcattttcagctaaaacgttggaaaaggcagagaaatgggaagcaaattggaca
aatccacaacaagtgtgtagcacaaaaggtgcatcagtaaaaggtgggattgggccattt
gggttactagtcttggcatctaaagacatgcaagaatatactgcaattttcttcagaatt
ttcagaggagataacaacaattttatagtcctcatgtgtagtgaccagaccaggtcttcc
ttacacttgccttctagtgattatgacaaaacaacttatggggccttgttgaatgtggat
cctcttcaagaaaaattgtctctcaggactttgattgatcactcaatagtggagagcttt
ggtggagaaggaaaagcttgcattacagctagggtttacccaactaatttagcagtggat
ggtgcaacccatttatatgtcttcaataatggttcacagagtgttgacatctcaaaattg
actgcttggagcatgaaaacagctcaaatcaattga

DBGET integrated database retrieval system