KEGG   Solanum tuberosum (potato): 102585018Help
Entry
102585018         CDS       T02981                                 

Definition
(RefSeq) alcohol dehydrogenase-like 4
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00010  Glycolysis / Gluconeogenesis
sot00071  Fatty acid degradation
sot00350  Tyrosine metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102585018
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102585018
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102585018
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102585018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 102585018
NCBI-ProteinID: XP_006343769
UniProt: M1AWF1
Position
Un
AA seq 380 aa AA seqDB search
MASKGKVITCRAAVAYGPGQPLVVEQVQVDPPQKMEVRIKILFTSICHTDLSAWKGESEA
QRAYPRILGHEASGVVESVGEGVIDMKEGDHVVPIFNGECGDCIYCKSSKKTNLCGKFRV
NPFKSVMDSDGKCRFRNKDGIPIYHFLNTSTFSDYTVVDYACLVKIDPHAPLDKMTLLSC
GVSTGLGAAWNTADVQTGETVAVFGLGAVGLAVVEGARTRGASKIIGVDINPEKRIKGEA
IGITDFINPKEIDVPVHEKIREMTEGGVHYSFECAGNMEVLREAFLCTHDGWGMAIVLGI
HPTPRLLSLHPMELFDGRRIVASVFGDFKGKSQLPLFAKQCMAGVVKLDEFITHRLPFEK
INEAIQLLLDGKSLRCLLHL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagggcaaggtcatcacttgcagagctgctgtagcgtatggtccggggcag
cccttggtggtagaacaagtgcaggtcgatccacctcagaaaatggaggtccgaattaag
atcctctttacttccatctgccatacggatctcagtgcttggaaaggcgagagcgaagct
caacgagcttaccctcgaattctgggacatgaagcgtcgggagtggtggagagcgtggga
gaaggtgtgattgacatgaaagagggagatcacgtagtaccgattttcaatggagaatgc
ggagactgcatttattgcaaatcatcaaagaaaaccaacttgtgtggcaagttccgcgtc
aatcccttcaaaagtgtgatggacagcgacggaaagtgcaggttcaggaacaaggatggg
atacccatttatcattttcttaatacttcaacatttagcgactatactgttgttgattat
gcttgcttagtcaaaattgatcctcatgccccacttgacaagatgaccttgcttagctgc
ggcgtatccactggtctaggggctgcgtggaacacggctgacgttcaaacaggggaaacg
gtggcagtctttggattaggagctgtcggtttggccgttgttgaaggggcacgaaccaga
ggcgcatcgaagatcataggagtggatattaaccctgaaaaacgtattaaaggtgaagca
attggaattactgacttcatcaatcccaaagaaatcgatgtgcccgtccatgagaaaata
agggaaatgactgagggaggcgtgcattatagctttgagtgtgctggaaatatggaagtt
ctccgagaggcatttttatgcacacatgatggatggggcatggcaatagttttaggaatt
catccgacaccaagattgttatcactccatccaatggaactgttcgatggccgaaggatt
gtggcttctgtctttggtgacttcaaaggaaaatcccaactccctctttttgctaaacaa
tgcatggctggggtggtgaaattagacgagtttattactcacagactgccatttgagaag
atcaatgaagctattcaattgcttctcgatggcaaatccttgagatgcctgcttcatctt
taa

DBGET integrated database retrieval system