KEGG   Solanum tuberosum (potato): 102586427Help
Entry
102586427         CDS       T02981                                 

Gene name
Cyp
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
sot  Solanum tuberosum (potato)
Brite
KEGG Orthology (KO) [BR:sot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102586427 (Cyp)
Enzymes [BR:sot01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102586427 (Cyp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 102586427
NCBI-ProteinID: NP_001275605
UniProt: Q9XF12
Position
Un
AA seq 171 aa AA seqDB search
MANPRVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF
HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKKHTGTGILSMANAGPGTNGSQFF
ICTAKTEWLDGKHVVFGQVVEGLDVIKKAEAVGSSSGRCSKPVVVADCGQL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatccaagggttttctttgaccttaccatcggcggtgcaccagctggccgcgtg
gtgatggagctcttcgccgataccactcccaaaaccgctgagaacttccgagctctctgt
accggtgaaaaaggtgttggaaagatgggtaagcctttgcactacaagggctcaaccttc
caccgtgtgatcccagggttcatgtgtcaaggaggtgatttcaccgccggaaacggtacc
ggaggagagtcgatctacggcgccaaattcaaggacgagaacttcgtgaagaagcacacc
ggcactggaattctctccatggctaatgctggacctggaaccaacggttcccagttcttc
atctgtaccgctaagactgagtggctcgatggaaagcacgtcgtgtttggacaagttgtt
gaaggcttggatgtgattaagaaggccgaggctgttggatctagttctggaaggtgctcc
aagcctgttgtggttgctgactgcggtcaactctag

DBGET integrated database retrieval system