KEGG   Solanum tuberosum (potato): 102589012Help
Entry
102589012         CDS       T02981                                 

Definition
(RefSeq) geranylgeranyl pyrophosphate synthase, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00900  Terpenoid backbone biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Module
sot_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102589012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sot01006]
    102589012
Enzymes [BR:sot01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     102589012
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     102589012
    2.5.1.29  geranylgeranyl diphosphate synthase
     102589012
Prenyltransferases [BR:sot01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   102589012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-GeneID: 102589012
NCBI-ProteinID: XP_006367299
UniProt: M1CP12
Position
Un
AA seq 375 aa AA seqDB search
MRSMNIVDSWGQACLVINQSLPYKSLNGMMKINLKNRRILKQTLSYRPFSSVTVSAIATT
REDEKVVKEEEEEEGAKMENEFNFKVYVAEKAISVNKALDEAIIVKDPPMIHEAMRYSLL
AGGKRVRPMLCIAACDLVGGNQGNAMAAACAIEMIHTMSLIHDDLPCMDDDDLRRGKPTN
HKVYGEDVAVLAGDALLAFAFEYLATATIEVSPSRILVAVAELAKSVGTEGLVAGQVADL
ACTGNPNVGLEMLEFIHIHKTAALLEASVVIGAILGGGADEEVDKLRRFARCIGLLFQVV
DDILDVTKSSEELGKTAGKDLAVDKTTYPKLLGLEKAKEFAAELNGEAKQQLAAFDSHKA
APLIALADYIAYRQN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagatctatgaatattgttgattcatggggtcaagcttgtttagttatcaatcaatct
ttaccctataaatccttaaatggaatgatgaaaatcaatctgaaaaatcgaagaattttg
aaacaaactttatcctatagaccattttcatctgtaactgtttcagctattgctaccact
agagaagatgagaaagttgttaaggaagaagaagaagaagaaggagcaaaaatggagaat
gaatttaatttcaaggtttacgtagctgaaaaggcgatttcagtaaataaagctttggat
gaggctataatagtaaaagacccacctatgatccatgaagcaatgcgttattcgcttctc
gccggcgggaagagagtccggccgatgctctgtatcgccgcctgtgaccttgttggggga
aaccaggggaatgctatggcggctgcttgtgctattgagatgatacatactatgtctctc
attcatgacgatttgccctgtatggatgacgacgatctccgccgtgggaagccgacgaat
cataaagtgtatggtgaggatgtggcggtcctcgccggagatgcgctccttgctttcgca
ttcgagtacctcgctaccgctacaatcgaagtttctccgtcgaggatcctcgttgctgtt
gccgaattggcgaaatctgttggaactgaagggttagtagctggacaagtagcggattta
gcttgtactggtaaccctaatgtgggattagaaatgctcgaatttattcacatacacaaa
acggcagcgttgctggaagcttccgttgtaatcggagcaatcctcggcggcggagcagat
gaagaagtggacaagttaaggagatttgcccgatgcatcggtttattgtttcaggtagtt
gatgatatccttgacgtgacaaagtcgtcggaggagcttggaaaaaccgccggaaaagat
ttggcggtggataaaacgacatatccaaagctgctgggattggaaaaggctaaggaattt
gcggcggagctcaacggcgaagctaaacaacagctggcggcgtttgattcacacaaagct
gctccattgattgctttagctgattacatcgcttatcgtcaaaattag

DBGET integrated database retrieval system