KEGG   Solanum tuberosum (potato): 102589433Help
Entry
102589433         CDS       T02981                                 

Definition
(RefSeq) putative uncharacterized protein At4g01020, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102589433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sot03041]
    102589433
Enzymes [BR:sot01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102589433
Spliceosome [BR:sot03041]
 Complex C
  Other components
   Step II factors
    102589433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-C3HC4_2 AAA_19 zf-RING_UBOX Helicase_RecD AAA_22 AAA_30 KH_1 ResIII ABC_tran AAA_29 DUF2075
Motif
Other DBs
NCBI-GeneID: 102589433
NCBI-ProteinID: XP_006346743
UniProt: M1C6E1
Position
Un
AA seq 1729 aa AA seqDB search
MHDSSSCNRQVPAPAMYHEHSYRLSNNRPCRPGYYSSSYELDRPPGHSHKSPNFVIQLRS
GNRRINRYALDDLIEKLPFAPRSSFVFSKGFLSGSLMYDQWSETLEVIVKLWRMRLSGSH
SFTPWVKRNVEVPSDEDELKARVKMVFLEELKGLLVEGELLQKWEKKLELLRDEICELSR
LLKNRNNLRVCNEFLKKREGLEKESDLIRKRIQEFKRGIECIIQQLEETSLKEEEGGSRV
FKIGTVFDWSKIHCLMMRECRRLDDGLPIFAFRQQILRQIHYQQVTVLIGETGSGKSTQL
VQFLADCGVTGNGSIVCTQPRKLAANSLAQRVKQESEGCYEDTSIICYPSYSSGHKFDSK
VVFMTDHCLLQHYMVDKNLSKISCIIVDEAHERSLDTDLLLALIKNLLLQRLDLRLVIMS
ATADAAQLADYFFGCGTFQVAGRTFPVDVEYVPCESTGCLGVGPISSYVYDVVKMVTEIH
ETEGEGTILAFLTSQIEVEWACEKFQTLSAISLPLHGKLSYEEQHRVFLSYPGKRKVIFT
TNVAETSLTIPGVKYVVDSGMVKESRFEPGTCMSILRICNVSQSSAKQRAGRAGRTGPGR
CYRLYSESDFEGMSHHQEPEIRKVHLGVAVLRILALGIKNVHDFDFVDAPSPKAIEMATR
NLVQLGAVWKKDDAYELTIEGHKIIKLGIEPRLGKLILSCFNQHLSREGVVLAAVMASSS
SIFCRVGSEGDKLKSDCLKVQFCHPNGDLFTLLSVYKEWEAVPKEGKNAWCWDNSINAKS
MRRCQETVQELEACLKSELNIIVASYWRWDPQMHTEHDETLKRIILSSLAENVAMYSGYD
QLGYEVALSEKYIQLHPSCSLLNFDRRPTWVVFGEILSAANEYLVCVTAFEFSSLSALSP
SPLFNFLEMDAQKLEKKVLTGFGSMLLKRFCGKSNSSVNNLVSRIRTKYMDERIGIQVNV
GKNEVLLYASSSDMESVLGQVNDALEYESKLLQNECLEKCLFSGGLAASASVALFGAGAI
VKHLELKKRILAVDIFHSNTKAVDDKELLMFLERNTSGDICAVHKSSGTGHDNEENRWGR
VTFLSPDAAKQAMLLNQVECSGGFLKVVPSRSVFCNDQKQFSSVLRTRVNWPRRCCNGVA
IVKCEPNDVGFMVKDFSVVMIGGNTIRSKPSNKYSDSIVISGLNTDHSETEVLEVLSGVT
DGKILDFFFVRGSAVENPPVAACEEALRREISPFMPKNVQSIRVQVFQPEPKDTYMRASI
MFDGSFHLEAAKALEHIDGKVLSGCLPWQKIRCQQQFHSSVSCPAPVYHVIRNQLDSLLL
CLQRRNGVECNLERNENGSYRVKISASATKIVAELRRPLEQLMKGKIVDHVGISLTVVQL
LFSREGNNIMKMVQQETGTYILFDRHSLSVRIFGSSDKIEMAERKFVNSLLALHESKQLE
VHLRGGLLPLDLMKRVVQSFGPDLSGLKLKVPNAEFSLNTKRHCISIKGTKDMKQKVEEI
ISEIAQSGLPSKMMDDETDCPICLCELEDAYRLEGCTHTFCRSCLLEQCESATRSREGFP
LCCMHKGCGAHILVSDLRSLLSSDKLEELFRASLGAFVAASVGRYRFCPSPDCPSVYHVT
ESGEVGAPFVCGACYVETCTSCHLEYHPYISCEKYKEFKDNPDFSLEEWAKGKENVKKCP
VCGFTIEKVDGCNHIECKCGKHVCWVCLVFFSSSDDCYNHLRSLHQAIM
NT seq 5190 nt NT seq  +upstreamnt  +downstreamnt
atgcatgattcttcctcctgcaatcgccaagtcccggctccggcgatgtatcacgagcac
agctatcgtctgtcaaataaccggccatgtcgtccgggttattattcttcgagttacgag
cttgatcgaccgccaggacattcgcacaagtcgccgaatttcgtaatccagcttcgttcc
ggtaaccggagaatcaaccggtacgcattagatgatctaattgagaaattaccgtttgcc
cctcgaagttcgtttgtttttagcaaagggttcctttctgggtcactgatgtatgatcaa
tggagcgaaacgcttgaagtgattgtgaaattatggagaatgaggctttcaggcagtcat
tcgtttaccccatgggttaaacgaaacgttgaggttccatctgatgaggatgaattaaaa
gctagggtaaaaatggtatttttggaggagttgaaagggttgttagtagagggtgaattg
ttacaaaagtgggagaaaaaattggaattgttgcgcgatgaaatttgtgaattgtcgaga
ttactgaagaataggaataatttgagggtgtgtaatgagtttctgaagaaaagggaaggt
cttgagaaggagagtgatttgatacggaagaggatacaggagtttaaaagaggaattgaa
tgtattattcaacagttggaggagacgagtttaaaggaggaggagggtggttcaagggtg
tttaagattgggacagtgtttgattggagtaaaattcattgtttgatgatgagggagtgt
cgcaggcttgatgatggcttgccaattttcgctttccggcagcagatactgaggcaaata
cattatcaacaggtgactgtcttaattggcgaaactggatcaggaaaaagtacgcaatta
gttcaattccttgctgattgtggggtaactggtaatgggtctatagtttgcactcaacct
cggaaacttgctgcgaattctttggcacaaagggtgaaacaggaaagtgaagggtgttac
gaagatacctctatcatctgctatccatcatattcatctggtcataagtttgattcaaaa
gtagtatttatgacggatcattgccttctacagcactatatggtcgataagaatttgtcc
aagatttcatgtatcatagttgatgaggcacatgaaagaagcctagacactgatctactt
ttagcattgataaagaatcttctccttcagaggcttgatctgaggcttgttattatgtct
gccacagctgatgcagcccagcttgcggattacttctttggctgcggaacattccaagtg
gctggtagaacttttccggttgatgttgaatatgttccgtgtgaatccactggatgtctt
ggtgttggcccaatctcctcctatgtgtatgatgttgtcaagatggtgactgaaatccat
gaaaccgagggagagggaacaattctagctttcttgacttctcagattgaagttgagtgg
gcttgtgagaagtttcaaacattgtcagctatttctttacctttacatggcaaactatcc
tatgaagagcagcatagagtttttctcagctatccgggaaagagaaaggtaatattcact
acaaatgttgctgagacatcattgacaattccaggggttaaatatgttgttgattctggc
atggtcaaagaaagcaggtttgagcctggcacttgcatgagtattctcaggatatgcaat
gtcagccagagctcagctaagcagcgggctggccgtgctgggagaactggaccaggaaga
tgttatcgactgtactcagaaagtgattttgaaggtatgtctcatcatcaggaacctgaa
attcgcaaggttcatcttggtgttgcagtgctgaggattcttgccttgggcatcaagaat
gtgcacgattttgattttgttgacgcacctagccctaaagctattgagatggccaccaga
aatctggtacagttaggagctgtttggaaaaaagacgatgcttatgaattaactatagaa
gggcacaaaataattaagttgggtattgaacctcggttaggcaaattgatcctcagttgt
tttaatcaacatttgagtagagaaggtgttgttcttgctgctgttatggctagttccagc
agcatcttttgtagggttggttctgaaggagacaaactaaaatccgattgcttgaaggtg
caattttgccatccaaatggtgatctcttcactttactttctgtttacaaggaatgggag
gctgtgcctaaggaaggaaagaatgcctggtgttgggataatagcatcaatgccaaatcc
atgagaagatgccaggagactgtgcaagaactggaagcttgccttaagagcgaacttaat
atcattgttgcaagctactggcgttgggatcctcagatgcataccgagcatgatgaaact
ttgaaaagaataatactttcttcacttgcagagaatgttgctatgtattctggatatgat
caattaggttatgaggttgcactaagtgaaaagtacatccaactacatccgtcctgttcg
ctgttaaattttgatcgacgaccaacctgggtagtgtttggtgaaatcctttctgcagct
aatgagtatctggtctgtgttactgcatttgagtttagttctctttctgctcttagtcct
tccccgttgtttaattttctggagatggatgcccaaaagctggaaaaaaaagttttgaca
ggtttcgggagcatgctattgaaaagattctgtggaaaatctaacagtagtgtcaataac
cttgtttcacgcattagaactaaatatatggatgaaaggattggcattcaagttaatgtt
ggtaagaatgaggttctgttatatgcttcatccagtgacatggagagtgttttgggtcaa
gtgaatgatgcactagagtatgaaagcaagttattgcagaatgaatgcttggagaaatgc
ctattcagtggtggattggctgcatcggcctcagttgccctctttggagctggtgcaatt
gttaaacatttggagcttaagaagagaatcttggctgttgacatatttcattcaaataca
aaagcagttgatgataaggaactgctgatgtttttggagagaaacacatcaggtgatatt
tgtgcagtgcacaagtcctcaggtactggccacgacaatgaggagaacagatggggcagg
gtaacatttctttcccctgatgctgctaaacaagctatgttgttgaatcaggtagaatgt
agtggtggctttctaaaagttgttccttcaaggagtgtattttgtaatgatcaaaagcag
ttctcctctgtcctcagaactagagtaaattggcctcgtagatgctgtaacggtgtagct
attgtaaaatgtgagccaaatgatgttggttttatggtaaaagatttctctgtcgtaatg
ataggtggaaacaccatccgttcaaagccaagcaataagtactctgacagcatagtaata
tcaggacttaataccgatcattctgagacagaggtactcgaggttttgagtggagtaaca
gatgggaaaattctagattttttctttgtgagaggaagtgctgtggaaaatcctccagtt
gcagcttgtgaagaagcacttaggagagaaatctcccccttcatgcctaaaaatgtccag
tctattcgtgttcaggtcttccaaccagaaccaaaggacacttacatgcgagcgtctatc
atgtttgatggaagttttcatcttgaagcagctaaggctttggagcatattgatggcaag
gttttatctggatgtcttccctggcagaagataagatgtcagcaacagttccacagctct
gtttcctgtcctgcacctgtttaccatgttattaggaaccagctggattctttactccta
tgcctccagcgaagaaatggtgtggagtgcaatctggagagaaatgagaatggttcttat
agggtaaaaatatctgcaagtgctacaaagattgtggcagaactgagaaggccattggag
caactgatgaaaggcaagattgtggatcatgtgggaatttctctaactgttgttcaactt
ctattttctagagaagggaataatatcatgaagatggttcagcaggaaacaggaacctat
attctttttgacaggcatagcctttctgtgagaatctttggttcctccgacaagattgag
atggctgagcggaagtttgttaactcccttctggcactacatgaaagcaagcaacttgaa
gtgcatcttcgtggaggacttttgcctcttgacctgatgaaaagagttgttcagagtttt
ggaccagatcttagtggtctcaaactaaaggtgcccaatgcagaattctctctgaacacc
aagcgccattgcatctctatcaaaggtaccaaagacatgaagcaaaaagttgaggagata
atttccgaaattgctcaaagtggtcttccaagtaaaatgatggacgatgagactgactgc
cccatttgcttgtgtgaactggaggatgcttacagacttgaaggttgtacccacaccttc
tgtcggtcgtgcttgctggagcagtgcgagtctgcaaccagaagccgggaaggtttcccg
ctatgctgtatgcataaaggttgtggggcacatattctggtttctgatttgaggtctctg
ttgtcgagtgataagttggaggaacttttcagggcttctttaggggcatttgtagcagca
agtgtgggtcgctaccggttttgcccctcccccgactgcccttcagtttatcatgttact
gaatcaggagaagttggtgcaccttttgtctgtggtgcatgctatgtggagacatgtacg
agttgccacctggagtatcacccctacatctcatgcgagaagtacaaggagttcaaggac
aacccggatttctctctagaggaatgggccaaggggaaagagaatgtgaagaaatgtcct
gtttgcggattcacgatagagaaggtagatggctgcaatcatatcgagtgcaagtgcgga
aaacatgtttgctgggtttgtttggtattcttcagtagcagcgacgattgctataaccat
ttgaggtctcttcaccaggccattatgtga

DBGET integrated database retrieval system