KEGG   Solanum tuberosum (potato): 102589435Help
Entry
102589435         CDS       T02981                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sot00603  Glycosphingolipid biosynthesis - globo and isoglobo series
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102589435
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    102589435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sot01003]
    102589435
Enzymes [BR:sot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     102589435
Glycosyltransferases [BR:sot01003]
 Glycan extension
  P blood group
   102589435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 102589435
NCBI-ProteinID: XP_006366365
Position
Un
AA seq 387 aa AA seqDB search
FALIISLIILYDSLIANISSKSIVFQININSLQPLKPPLANRPLFSMKEETNNEVYLKDE
EEDYAHLVPPYNLSQEERISWFKKNLPYFEILKSTNISRKFNGRMNEFFTSHYCSVQFFM
TWISPTKSFGKIEFFTLESLFKAHPKGCLIILSHTLDSPSGTMIFKSLVELGYRILLVTP
DLYFLFENTPSKSWFIDLKNGKKDPGKIPLAQNLSNLIRLAVLYKYGGVYLDTDFIILKD
FSRLRNSIGAQSVDRNGNWTRLNNAVLIFDKSHPLVYKFMEEFALSFDGNRWGYNGPYLV
SRVVEKVKDYNFSVLPPRAFYPMNWIRIKGFFNAKNDSRWIEAKVLELNEKTYGIHLWNR
QSKSMKIEQGSIIDRLISTHCVVCNDI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
tttgctttgatcatttcccttataatcctctatgattctctcatagctaatatttcatcc
aaatcaattgtctttcaaatcaatatcaattccttgcaaccattgaaaccacctttagct
aatcgaccgttgttttcgatgaaggaagagactaataatgaagtttatttgaaggacgaa
gaagaagattatgcacatttggtgcctccttataatctctcacaagaagaaagaatctct
tggttcaagaaaaacttgccatattttgagatattaaagtccacaaatatctcaagaaaa
ttcaatggtagaatgaatgaattttttacaagtcattattgtagtgtccaattcttcatg
acatggatttcccctacaaaatcatttggtaaaatagaatttttcaccttagagagtcta
ttcaaagcacatcctaaagggtgtttgataatattgtcacatactttagactcaccaagt
ggaactatgatatttaaatctttagttgagttgggctatagaattcttcttgtcactcct
gatttgtattttttgtttgaaaatactccatctaaatcttggtttattgatctcaagaat
gggaaaaaggaccctggtaaaattcctttggcacaaaatttgtctaatttgattagacta
gccgtgttgtacaagtatggtggtgtttatctagacacggatttcattatcttgaaggat
ttttcaagattgaggaactcaattggtgcacaaagtgtggatagaaatgggaattggaca
agattgaataatgcagtattgatttttgataaaagtcatccacttgtttacaaattcatg
gaggaatttgctttgagttttgatggaaatagatggggatataatggaccatacttggtt
tcaagagttgtagagaaggtaaaagattacaactttagtgtcttgccaccaagagctttt
tatccaatgaattggattagaattaaaggattttttaatgctaaaaatgattcaagatgg
atagaggctaaagtgcttgagctaaatgagaagacttatggtattcacttgtggaataga
caaagtaaaagtatgaaaattgaacaaggaagcatcatagatagattaatatctactcat
tgtgtggtatgtaatgacatttaa

DBGET integrated database retrieval system