KEGG   Solanum tuberosum (potato): 102590563Help
Entry
102590563         CDS       T02981                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102590563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sot03041]
    102590563
Enzymes [BR:sot01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102590563
Spliceosome [BR:sot03041]
 Complex C
  Other components
   Step II factors
    102590563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE DUF2075 ABC_tran Sigma54_activ_2 AAA_16 Flavi_DEAD PhoH
Motif
Other DBs
NCBI-GeneID: 102590563
NCBI-ProteinID: XP_015169028
UniProt: M1BZT2
Position
Un
AA seq 1141 aa AA seqDB search
MGTDTEENELEKLEYLSLISKVCSELEAHLGFGDKVLAEFITELGRNCSTVDEFDAKLKE
SGAEMPDYFVKTLLTIIHAILPPKVTSKSDKDFNKDDNDSEFSALKIRDNRERVKELEKE
IELEAKSKRRDVEEEECGSRRERDRDYRRERCRDRDRGRDRDRDDYDDGRAERMTSERHR
DRDRDRDNEDDAYAKGRRDEYEQESDDDRRDMRKSRHHVDEPELYAVYKGRVSRVMDSGC
FVQLSDFRGKEGLVHVSQLATRRVTNAKDLVKRDQEVFVKVISISGQKLSLSMRDVDQNT
GKDLLPLKKSLGDDRLTTNPSTMNGEGSKTRIGLSGIRIMEQEDVIPSRRPLKRMSSPEK
WEGKQLIAAGVLGVQEHPMFDEEGNGMLYQEEGAEEELEVELNEDEPPFLQGQSRYSVDM
SPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGER
HLAQELRGVGLSSYDMPEWKKDAYGKALTFGQRSKLSLQEQRQSLPIYKLKKELVQAVLD
NQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVATMSVAKRVAEEFGCRLGE
EVGYAIRFEDCTGPETVIKYMTDGMLLREILIDDNLSQYSVVMLDEAHERTIHTYVLFGL
LKQLMKRRPDLRLIITSATLDAEKFSGYFFDCNIFTIPGRTFPVEILYTKQPESDYLDAA
LITVMQIHLTEPEGDILLFLTGQEEIDYACQCLYERMKGLGKNVPELIILPVYSALPSEM
QSRIFYPAPPGKRKVVVATNIAEASLTIDGIYYVIDPGFAKQNVYNPKQGLDSLVITPIS
QASAKQRAGRAGRTGPGKCYRLYTESAFHSEMSPTAIPEIQRINLGNTVLMMKAMGINDL
LSFDFMDPPSPQALISAMEQLYTLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLG
YSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKNFQPEGDHLTLLAVYEAWKAKNFSGP
WCFENFVQSRSLKRAHDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAIGAGFFFHVARKDP
QEGYRTLVENRPVYIHPSSALFQRQPDWVIYHELVMTTKKYMREVTVAPYFEQAETVHNI
I
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgacactgaagaaaatgagttggagaaattggaatatctctctctaatttct
aaggtatgttctgaattggaagcacatttagggtttggtgataaagttttagctgaattt
ataactgaacttggtagaaattgctcaacagtagatgaatttgatgctaaattgaaagaa
agtggtgctgaaatgcctgattattttgttaaaacattgctaactataatacatgctatt
ttgcctcctaaagtcacgtcgaagtcggacaaggatttcaataaggatgataatgattct
gagttttccgctctcaagataagagataatagagaacgagttaaggaattggaaaaggag
attgagctggaagccaagagtaagaggagagatgtggaggaagaagaatgcggtagtagg
cgagagagggatagagattatagaagagaaaggtgtagagacagggatagaggtagggat
cgagatagggatgattatgatgatggtagagctgaacgtatgacttcagaaaggcacaga
gacagagacagggacagggataatgaggatgatgcatatgcaaaaggtaggagagatgag
tatgagcaagaaagcgatgatgatcggagggatatgagaaaatcaaggcatcacgtggat
gagccagaattgtatgcagtatataaggggagggtatcaagggtgatggattctggttgt
tttgttcagctgagtgattttagagggaaagaaggcttggtgcatgtttcacaacttgct
actagaagggtcactaatgccaaagatttagtaaagcgggaccaggaggtttttgtgaag
gttatatctattagtgggcagaagctgagtttgtcaatgagagatgttgatcagaataca
ggaaaggatctgttgccattgaaaaagagcttaggcgacgatcggttgacaactaatcct
tcaaccatgaatggtgaaggttctaagaccaggattggtctgtcaggaatcaggattatg
gagcaggaggatgtaattccatcacgtagaccgctgaagaggatgagttcacctgaaaaa
tgggaagggaaacaacttattgctgcaggtgttttgggggtgcaggaacatcccatgttt
gatgaagaagggaacggaatgctctatcaggaagaaggtgctgaagaagagcttgaggtt
gagttgaacgaagatgaaccccctttcttgcaagggcagagtcgttattcagttgatatg
tcccctgttaaaatttttaaaaatcctgaaggatcattgagtcgtgctgctgcactacaa
tcagctctgataaaggagagaagggaagtaagagagcagcaacagagaacgatgcttgat
tccatccctaaagatctcaacagaccctgggaagacccaatgccagagacaggtgagagg
catctagcacaggagcttaggggtgttggtttgtcttcctatgacatgccagaatggaag
aaggatgcttatggtaaagccttgacctttggccagaggtctaagctatccctccaggag
cagaggcagagtcttcctatttacaaattgaagaaagaactggttcaggctgtccttgat
aaccaggtcctggttgtcatcggtgagacaggttctggtaagacaacacaggtgacacag
tatctagccgaggcagggtatacaacgaggggaaaaattggctgtactcaacctcgtcga
gtggctacaatgtcagtggctaagagagttgctgaggagtttggttgtcgattaggtgaa
gaagttggttatgctattcgttttgaagattgtactgggccagaaactgttatcaaatat
atgactgatggtatgcttctgagggagatcctgattgatgataacttatcccagtattca
gtcgtaatgcttgatgaagcacatgaaagaacaattcacacttatgttctctttggtttg
cttaagcagcttatgaagaggagacctgaccttcgtctaattatcacatctgcaactttg
gatgcagagaaattttctggttatttcttcgactgcaacatctttacaatcccaggaaga
acttttccagtagagatactctacacaaagcagccagaaagtgattaccttgatgcggct
ttaattactgttatgcagatccacttgacagaacctgaaggtgatatcctcctcttcttg
actggtcaagaggagattgattatgcttgtcagtgtctctatgagaggatgaaaggacta
ggtaaaaatgttcctgaactgatcatactgcctgtctatagtgccttgcccagtgaaatg
cagtctagaattttttatcctgcccctcctgggaagagaaaagttgttgttgctacaaat
attgctgaagcttctttgacaattgacggtatatattatgttattgatcctggattcgca
aagcaaaatgtctacaatccaaaacaggggcttgattcactagttattaccccaatttca
caagcatcagcaaagcaacgagcagggcgtgctggacgaactggacctgggaagtgctac
cgtctgtatactgagagtgctttccatagtgaaatgtcccctaccgcgattccagaaatc
cagaggataaatcttgggaacacggttcttatgatgaaagcaatgggtattaatgatctt
ttgtcatttgatttcatggacccaccttcccctcaggctctcatatctgccatggagcaa
ctttatactcttggagcattggatgaagaggggcttctgacgaaactgggaagaaaaatg
gcagaatttccattagatcctcctttgtccaagatgcttcttgctagcgtggaccttggc
tatagtgatgagatcttgaccatcattgctatgattcaaactggaaatatcttttaccga
ccaagagaaaaacaagctcaggccgatcagaaaagggccaaaaattttcagcctgagggt
gatcaccttaccttgcttgctgtttatgaggcttggaaagcaaaaaacttctcaggtcca
tggtgttttgaaaattttgtccagtcacgatcacttaagagggcacatgatgttagaaaa
cagctgctttcgatcatggataagtataaattggatgttgtaagtgctggaaagaatttc
acaaagatccggaaggctattggagcaggtttcttttttcatgttgctagaaaggatcct
caagagggttatagaactctagttgagaaccggccagtttacatccatcctagcagtgct
ctttttcaaagacagccggactgggttatttatcacgagcttgttatgacaacaaagaag
tacatgcgcgaggtgactgtcgcaccctatttcgaacaagccgaaacagttcacaacata
atatga

DBGET integrated database retrieval system