KEGG   Solanum tuberosum (potato): 102590845Help
Entry
102590845         CDS       T02981                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sot  Solanum tuberosum (potato)
Brite
KEGG Orthology (KO) [BR:sot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sot04131]
    102590845
Membrane trafficking [BR:sot04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102590845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 102590845
NCBI-ProteinID: XP_006364260
Position
Un
AA seq 1836 aa AA seqDB search
METSSSGYRFRRIPHHSFAGSLNLDPLLDENLEQWPHLNELVQCYRTDWVKDENKYGHYE
SVSPTSFQSQIYEGPDTDIETEMHLANARRPKIEDSIDGEIPSTSGTQLSEDNFSDLSNA
KVSKHFGESPLPTYEPVFDWENERSLIFGQRIPEAHMSQYTSGLKIAVKVLSLSFQSGLV
EPFYGTICLYNRERREKLSEDFIFHVLPTEMQEASSSYERRCIFHLDAPSASICLLIQLE
KPATEEGGVSPSVYSRKEPVHLTEREKQKLQVWSRIMPYRESFSWAIIPLFDSNIASVGG
SASPSSPLAPSVSASSSQEGITEPLSKITADGKLGYSNGNSIVVEVSNLNKVKEGYTEES
LQDPKRKVHKPVKGVLKLEIEKLPASSTEAENALESGSLIYDSIDHGDHLNDSTSMKCPA
NGSFSKSKSSEMKELVRNGSVAHENVENTADDFEAFDFRTTTRNEPFLQLFHCLYVYPLT
VSMSRKRNMFIRVELRRDDTDIRKPPLEAMHPREPGVPLQKWSHTQVAVGARVASYHDEI
KVSLPVIWTPSHHLLFTFYHVDLQTKLEAPKPVVIGYASLPLSTHAQFRSEISLPIMKEL
VPHYLQESGKERLDYLEDGKNIFKLRLRLCSSLYPVSERIRDFFLEYDRHTLRTSPPWGS
ELLEAINSLKNVDSTALLQFLYPILNMLLHLIGNGGETLQVAAFRAMVNILTRVQQESVD
EAERNAFLVNFVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWF
FLELIVKSMALEQARSFYHNLPSGEDVPPMQLKEGVFRCVVQLYDCLLTEVHERCKKGLS
LAKHLNSSLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQTVLHDCKLTFLQIICDHDL
FVEMPGRDPSDRNYLSSILIQEIFLTWDHDDLSMRAKAARILVVLMCKHEFDIRYQKLED
KLYIAQLYFPLVGQILDEMPVFYNLSTIEKREVLIIFLQIVRNLDDETLVKAWEQSIART
RLFFKLLEECLMHFEHRKPADGMLVGSSSRSVIGEGPSSPKYSDRLSPAINHYMSEAARQ
EVRGTPDNGYLWQRVNSQLSSPSQPYSLREALAQAQSSRIGASALALRESLHPILRQKLE
LWEENLSAAVSLQVLEVSEKFSRTAATKRIATDYGKLDCITSIFMNVFSRNQPLSFWKAL
FPVFNKVFELHGATLMARENDRFLKQIAFHLLRLAVFRNDNIRRRAVIGLQILIRSSFSY
FMQTGRLRVMLTITLSELMSEVQVTQMKPDGTLEESGEARRLRNSLEEMADEAKSSSLLL
ESGLPQNALAAVPEGSAENLWSWSEVKFLSESLLMALDASLEHALLGSVMNVDRYAAAES
FYKLAMAFAPVPDLHIMWLLHLCEAHQEMQSWAEAAQCAVAVAGVVMQALVCRNDGVWSK
DHVSALRKICPMVSSDITSEASAAEVEGYGASKLTVDSAVKYLQLANKLFHQAELFHFCA
SILELVIPVNKSRKAYGQLAKCHTTLTNIYESILEQESSPIPFTDATYYRVGFYGEKFGK
LDRKEYVYREPRDVRLGDIMEKLSHIYESRMDGTTLHVIPDSRQVKADELQPGVCYLQIT
AVDPVMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVL
QTEGSFPALVNRLLVIKCESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQS
LQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHF
RLIGEEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcatctagtggatatcgatttcggagaataccacaccattccttcgctggt
tccttgaatttagatccactgcttgatgaaaatttggagcagtggccacatttaaatgaa
ctagtgcaatgctacagaaccgactgggtaaaagatgagaacaagtatggtcactatgaa
agcgtcagcccgacttcatttcagagtcaaatatatgagggtcctgatactgatattgaa
acagaaatgcatcttgcaaatgctagacggcctaagattgaggattcaattgatggtgaa
atccccagcacttctgggacacaactctctgaagataatttctctgacctctcaaatgcc
aaagtctccaagcattttggtgaatcccctctaccgacttatgaaccagtttttgactgg
gaaaatgaaagatcattaatatttgggcaaaggattcctgaagctcatatgtcccagtat
acgagcggtctgaagattgctgtgaaagtcctatcattatcatttcaatctggactagtt
gagccgttttatggcacaatttgtttatataatagggagcgaagagaaaaactttctgag
gattttattttccatgtattgcctaccgaaatgcaagaagcaagcagttcctatgaaagg
cgttgcatttttcatctagatgctccatcagcatctatttgtctgctaatccaactagaa
aaacctgccactgaagaaggtggagtgtcaccttctgtttattcacgaaaggaaccagtt
catctgacagagagagagaaacagaaactacaagtatggtcgcggatcatgccttacagg
gagtccttttcctgggccatcattccactctttgatagtaacatagcttctgtgggtggc
tctgcttctcccagcagccctcttgctcccagcgtctctgcttcaagttcacaagagggt
atcactgagccactttcaaaaattacagcagatggaaagcttggttattcaaatggaaac
tccatcgtcgttgaagtgtctaacttaaacaaagtcaaagaaggatacactgaggaatct
ctccaggatccaaagagaaaggttcataaaccagtaaaaggtgtcttgaaattggaaatc
gaaaagctgccagctagctctactgaagctgaaaatgctttggagagtggtagtttgatc
tatgattctattgatcatggcgaccatttgaatgattcaacttctatgaaatgccctgct
aatggttccttttccaagtctaaatcctctgagatgaaagagcttgttcggaatggttcg
gttgctcatgaaaatgtggaaaatactgctgatgattttgaagcttttgacttccgcaca
acgacaaggaatgaaccgttcttgcagctctttcactgcttatatgtctaccccttgact
gttagtatgagtcggaaacgaaacatgtttattcgtgttgaactgagaagggacgacaca
gatattcgaaaaccacctctagaggctatgcatccaagggaaccaggtgtaccacttcag
aaatggtctcacacacaagttgctgtgggggcaagggtggccagctaccatgatgaaatc
aaagtttctttgcctgttatttggacaccatcacatcaccttttgtttactttctatcat
gttgatcttcagacaaaacttgaagcaccaaagccggtggtaattggatacgcttcactt
ccattatcgacacatgcacagttcagatctgagatatccttgccaatcatgaaagaattg
gttcctcattatcttcaagaaagtggcaaggaaaggctggattacttggaagatggaaag
aatatcttcaagcttcgtttacgattatgttcatcattatacccagttagtgagcgcatt
agggattttttcctcgagtatgataggcatactctacggacaagccccccttggggatct
gaacttcttgaggcaatcaatagcttgaagaatgttgattccactgctttgcttcaattt
ctttatccaatcttaaacatgcttctccatcttattggcaatgggggagaaactcttcag
gttgctgcctttagagctatggttaacattttaacaagggtgcagcaagagtcggttgat
gaagctgagagaaatgctttcctggtaaactttgttgattatgcttttgatgattttggc
ggccgccagccaccagtgtatcctggtttgtccacagtgtggggaagtttggctcgcagt
aaggcaaaagggtaccgcgttgggcctgtctatgatgatgtcttggcaatggcttggttt
tttcttgagttaattgtcaagtcaatggcactggagcaggctcgatccttctatcacaat
cttccatcaggtgaagatgtcccgccaatgcaattgaaagaaggtgttttcagatgtgtt
gttcagttgtatgattgccttttaacagaagttcatgaacgctgcaagaaaggtctaagc
ctggccaagcatttaaatagtagtttggctttcttttgttatgatcttttatccatcatt
gagcctcgtcaggtttttgaactggtgtccttgtatctcgataaattctctggagtgtgt
caaacggtgctgcatgactgcaagcttacctttctacaaattatatgcgatcacgatctt
tttgttgaaatgcctggacgagatccttctgataggaactatctttcatctatcttaatt
caagagattttccttacatgggatcatgatgacttgtcaatgagggcaaaagctgcaaga
atcttggtggtcctcatgtgtaagcacgagtttgatatccgctaccaaaagctagaggat
aaattatatattgctcaattatattttccccttgttggccagatcctggatgagatgcct
gtcttttacaatctgagtacaattgaaaagcgtgaagtcttgattatatttctgcaaata
gtgcgcaacttggacgatgaaacacttgttaaagcttgggagcagagcattgcccgtacc
agattattctttaaactcttagaagagtgcttgatgcattttgagcataggaaaccagct
gatggcatgcttgttggtagtagttctcgtagtgttataggggagggaccttcatcccca
aaatattctgacagactttcacctgcaattaaccactatatgtctgaggcagcaaggcaa
gaagtcagaggaactccggataatggctatttgtggcagcgggttaactcccaattaagc
tcgcctagtcagccatattctttgagagaagccctagctcaagcccagtcctccagaatt
ggagcttcagcactagcattaagggaatccttgcatccaatcttaaggcaaaagctggaa
ctttgggaagagaacctgagtgctgctgttagtcttcaagttttagaagtttctgagaag
ttctcacggactgccgcaacgaagcgtattgctactgattatggaaaacttgactgtatc
acatccatatttatgaatgtgttctcacgaaaccaaccactctctttctggaaagcacta
tttcctgtcttcaacaaagtctttgaacttcatggagctacattgatggcaagagaaaat
gatcgtttcttaaagcaaattgctttccaccttcttcggcttgcagtgtttcgaaatgac
aatatcagaagaagggctgtaattgggctgcagatacttattcggagctcgttctcttat
tttatgcagacgggaagattaagagtcatgctaaccattacattgtcagagttaatgtct
gaagttcaagtaacacaaatgaaacctgatggaacactagaagaaagtggtgaagctcgt
cgtcttcgaaattctttggaggaaatggcagatgaggctaagagttcctccttattactt
gagtctgggctcccacaaaatgcactggctgctgttccagaaggatcagcagaaaacctc
tggtcctggtctgaggtgaaatttctttctgagagtcttcttatggctcttgatgccagc
ctggaacatgcacttctgggttctgttatgaatgtcgacaggtatgcagctgcagagagc
ttttataaactagcgatggcatttgctcctgtaccagatcttcacataatgtggttacta
catctttgtgaagctcatcaggaaatgcagtcttgggctgaagctgctcaatgtgctgtt
gctgttgctggtgtagtgatgcaggcccttgtgtgtaggaatgatggtgtctggagcaag
gatcacgtgagtgcattacgcaaaatatgccccatggtcagcagtgacatcacttctgag
gcttcagcagctgaggtggagggatatggtgcttcaaaactcacagttgactcggctgtg
aagtatttacagcttgcaaataagcttttccatcaggctgagttgttccatttctgtgca
agcattctagaacttgtaatcccagtaaataaaagcaggaaggcatatggacagcttgca
aaatgccacacaacgcttactaatatctacgagtccatccttgagcaggaatcaagccct
attcctttcacagacgccacatattatagagttggattttatggtgagaagtttgggaag
ctggacaggaaagaatatgtttatagagagcctcgcgatgtgcgattaggtgacataatg
gagaaattgagccatatctatgagtcgagaatggatggaactacattacacgtaattcct
gattcaagacaagtcaaagcagatgagttgcagcctggagtctgctacctgcaaataact
gcagttgatccggtaatggaggatgaagatttaggaagcagaagggaaaggatattctct
ctctctacaggaagtgtccgtgctcgtgtctttgatcggtttttgtttgatactcctttc
actaaaaatggtaagacccaaggaggcttggaagaccaatggaagcggcgaacagttctg
caaactgagggatcttttcctgcgctagtgaatcgactcttggttatcaaatgcgaatcc
cttgagttctccccagttgagaacgcaattggaatgattgaaactaggacagctgcatta
aggaatgaacttgaagagcctagaagctcagaaggtgatcaacttccccgtttgcagagt
ttacagaggattcttcaaggttcagttgcagttcaagttaacagtggagtcctcagcgtc
tgtacagctttcctttctggtgagcctgcaaccaggttgcgttcacaggaactacaacaa
cttattgctgcccttcttgaatttatggctgtgtgcaaacgtgctattcgagtacacttt
aggttgatcggggaagaagatcaggattttcatactcagcttgttaacgggttccagtct
ctcactgcagaactatcacattatattcctgcaattctttcagagctttag

DBGET integrated database retrieval system