KEGG   Solanum tuberosum (potato): 102590865Help
Entry
102590865         CDS       T02981                                 

Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00600  Sphingolipid metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102590865
Enzymes [BR:sot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     102590865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat NO_synthase
Motif
Other DBs
NCBI-GeneID: 102590865
NCBI-ProteinID: XP_006347124
Position
Un
AA seq 487 aa AA seqDB search
MRLTETEILTMDPTDAGAPLLSDRVQISGNVVPMTLTTGGKLRWPDRCLSIAKDVLGFTV
EGSRIKINAVIESGPGICCPSNVGAPMRKTFTFEPLSEDSLRLWNQRLQSVIDSLGRPKR
LLVLLNPYGGSRSAPKVFSDDVKPLLDDANIHYTLQETKYRLHAKEVAHSLDLMGYDGVL
CVSGDGILVEVVNGLLEREDWSSAIKMPLGVIPAGTSNGMAKSLLDSVGESCTAFNATLA
IIRGHKRSLDVATVLQGQKKYFSVLMLAWGLIADIDIESEKYRWMGSARMDFYAIQRIFC
LRKYHGCIKFVAAPGFENFGEPNELGGEIDELNSNWVMQDGYCGPTFDMKGFNRKIEGPF
VSIWLHNVPWGGEDVLAAPDAKFSDGYLDLIVMKDCPKISLATLMGEMNKGGHVRSPHVL
YLKVKAFALEPGPRADDPNKEGIIDVDGEVLARGKGTYKCDQKTLMTYDKLHIKVDQGLA
TVFSPIN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgacggaaaccgagatattaacaatggatccgacggacgccggagctcctctt
ctatctgatcgggttcaaatcagcggcaatgtagttccgatgactctcactaccggagga
aaactccgatggcctgaccggtgtttgtcaattgcgaaagatgtactcggcttcaccgtc
gaaggttctcggatcaaaatcaatgccgtcattgagagtggacctggaatttgctgcccc
agtaatgtaggagctccgatgaggaagactttcacttttgagccattgtctgaggattct
cttcggctttggaatcaacgactccaatccgtcatcgattcactcggtcgtcctaagaga
cttcttgtacttctgaatccatatggaggaagccgatctgcacccaaagtatttagtgac
gatgtaaagcccctgctcgatgatgcaaatattcactacacactgcaagaaactaaatat
cgattacatgcgaaggaagttgctcattcattggatcttatgggatatgatggagttctt
tgtgtcagtggtgatggcattttggttgaggtagtgaatggactgcttgaaagggaggat
tggagttctgcaataaagatgcctctaggagtaatacctgcaggaacttcaaatgggatg
gcaaagtctcttctagattctgttggtgaatcttgtactgcatttaatgcaactcttgct
ataattagagggcacaagagatcactagatgtagctacagttctacaggggcagaaaaaa
tatttcagtgtgctgatgcttgcctggggtcttatagctgatatagatatagagtctgag
aagtataggtggatgggtagtgctcgaatggatttttatgcaatacagcggatattttgt
cttagaaagtatcatggctgtatcaaatttgtggctgcaccagggtttgaaaattttgga
gaaccaaatgaacttggaggtgaaattgatgagcttaactcgaattgggttatgcaagat
ggctattgtggtcctacttttgacatgaagggtttcaaccgcaagattgaggggcctttt
gtctcaatctggcttcataatgtaccttggggaggtgaagatgttctggcagcacctgat
gccaagttttcagatggttacttggacttgattgtgatgaaggattgcccaaaaatatcc
ttggcaacactgatgggcgagatgaacaaaggtggtcatgttagatcaccacatgtcttg
tacttgaaggtaaaggctttcgctttagagcctggtccacgagcagatgacccaaacaag
gaagggattattgatgtagacggtgaggtccttgccagaggtaaaggaacttacaagtgt
gatcagaaaacattgatgacctacgacaagctccatatcaaagtagatcaagggttggct
actgtattttctcctatcaattaa

DBGET integrated database retrieval system