KEGG   Solanum tuberosum (potato): 102591877Help
Entry
102591877         CDS       T02981                                 

Definition
(RefSeq) delta-amyrin synthase
  KO
K21928  delta/alpha/beta-amyrin synthase [EC:5.4.99.55 5.4.99.40 5.4.99.39]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00909  Sesquiterpenoid and triterpenoid biosynthesis
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    102591877
Enzymes [BR:sot01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     102591877
    5.4.99.40  alpha-amyrin synthase
     102591877
    5.4.99.55  delta-amyrin synthase
     102591877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement
Motif
Other DBs
NCBI-GeneID: 102591877
NCBI-ProteinID: XP_006364889
Position
Un
AA seq 760 aa AA seqDB search
MWKLTIAQGQDAYLYSTNNYVGRQTWEFDPNSGTAEELAEIEKARQQFWNNHYKIKPNSD
LLWRMQFLREKNFKQRIGAVKVEEGEEISHEIATIALRRAVHFFSALQATDGHWPAESAG
PLFFLPPLVMCMYITGHLNTVFPAEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCTALS
YVCMRILGEGPDGGVNNACARARKWILDHGSVIAIPSWGKTWLSILGAFEWIGTNPMPPE
FWILPSFLPVHPAKMWCYCRTVYMPMSYLYGKRFVGPITPLILQLREELYDQPYDEINWK
KVRHVCAKEDLYYPHPLVQDLMWDSLYICTEPLLTRWPFNKLRNKALEVTMKHIHYEDEN
SRYITMGCVEKVLSMLACWVEDPNGDHFKKHLARIPDYLWVAEDGMKMQGCGSQSWDASL
AIQALLASEMNDEISDTLRKGHDFIKQSQVKDNPSGDFKGMYRHISKGSWAFADQDHGWQ
VSDCTAEALTCCLLFSTMPPELVGEAMDPVRLYDSVNVILSLQSKNGGLAGWEPAGAAEY
LELLNPTEFFEDIVIEHEHVECTSSAIQALVRFKKIYPGHRTTEVDNFINNGVKYIEDVQ
KPDGSWYGNWGVCFIYASWFALGGLAAVGLSYRNCAAVRKGVEFLLRTQRSDGGWGESYR
SCPDKVYRELETEHSNLVQTAWALMGLIHSGQVDRDPRPLHRAAKLLINSQMEDGDFPQQ
EIIGVFLRNCMMHYASYRNIFPLWGLAEYRRNVLVPLKHN
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaattgacgattgctcaagggcaagatgcatatttatacagcacaaataactac
gttggacgacaaacgtgggagttcgacccaaatagtggaacggcagaagaactggccgag
attgaaaaggcccgtcaacaattttggaacaatcattataaaatcaagcctaatagcgat
cttctttggagaatgcagttcctcagagagaagaatttcaaacagagaattggagcagta
aaagtagaagaaggagaagaaattagccatgaaattgctacaattgcattgcgtagagct
gtccatttcttctcagctttacaggctactgatggacattggcctgctgaaagtgctgga
cctctcttctttcttccccctctggttatgtgtatgtatatcactgggcatcttaatacc
gtattcccagctgaacatcggaaggaaattcttcgatatatatactgtcaccagaatgaa
gatggtggatggggtttgcacatagaaggtcacagtactatgttctgtacagctctgagt
tacgtttgcatgaggatccttggagaaggaccagatggtggcgtaaacaatgcttgtgct
agagcaaggaaatggattcttgatcatggtagtgtcatcgccattccttcttggggaaaa
acatggctctcgattcttggagctttcgaatggataggaaccaatccaatgccacctgag
ttttggattcttccatcttttcttcccgtgcatccagcaaaaatgtggtgttactgccga
acggtctacatgccaatgtcttatctctatgggaagagatttgttggtccaatcacacct
ctcattttgcaattgagggaagagctgtatgatcagccatatgatgaaattaactggaaa
aaagtgcgccatgtatgtgctaaggaggatctttattacccgcatccattggttcaagat
ttgatgtgggatagtctctacatatgtaccgagcctctattgactcgttggcctttcaac
aagctgagaaataaagctcttgaagttaccatgaaacacatacactacgaagacgagaat
agtcgatacatcaccatgggatgtgtggaaaaagtattgagtatgcttgcttgttgggtt
gaggatcccaatggcgatcatttcaaaaaacatcttgctaggatcccagattatttatgg
gtagctgaagatggaatgaaaatgcagggttgtggtagtcaatcatgggatgctagttta
gctattcaagcactattggccagtgagatgaatgatgagatatcagatactcttagaaag
ggacatgactttataaaacaatctcaggtgaaggacaatccttctggtgattttaaaggt
atgtatcggcatatctcaaaaggatcatgggcttttgcagatcaagatcatggatggcaa
gtatctgattgcactgccgaagcattaacgtgctgccttctcttctctacaatgcctcct
gaattagttggtgaggcaatggatccagtgcgactgtatgactcggtgaatgttattctt
tcattacagagcaagaatgggggtttagcaggatgggaacctgcaggggccgcagagtat
ttggagttgctcaatcctactgaatttttcgaggatattgttattgagcatgagcatgtt
gagtgcactagctcggcaatccaagcacttgttcgttttaagaagatataccctggacac
cgaactacggaggttgacaattttattaataatggtgttaaatatattgaagatgtacag
aagcctgacggttcatggtatggtaactggggtgtgtgcttcatatatgcttcctggttt
gctcttggagggcttgctgctgtaggcttgtcgtacagaaactgtgcagctgttcgtaaa
ggcgtagaatttcttctaagaacacaaaggtctgatggtggttggggagaaagctaccgt
tcttgtcctgacaaggtatatagagagcttgaaacagaacactcgaatcttgtacaaact
gcatgggcattgatgggattgattcactctggccaggttgatagagatccaaggcccctc
caccgcgcagcaaagctattgattaattctcagatggaagatggtgacttcccacagcag
gaaataattggtgttttcttgaggaattgtatgatgcactatgcatcatatagaaatata
tttccattgtggggattggcagaataccgcagaaatgtcttagtaccattaaaacacaac
taa

DBGET integrated database retrieval system