KEGG   Solanum tuberosum (potato): 102593436Help
Entry
102593436         CDS       T02981                                 

Definition
(RefSeq) beta-glucosidase BoGH3B-like
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00460  Cyanoamino acid metabolism
sot00500  Starch and sucrose metabolism
sot00940  Phenylpropanoid biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102593436
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    102593436
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    102593436
Enzymes [BR:sot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     102593436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C IGFL
Motif
Other DBs
NCBI-GeneID: 102593436
NCBI-ProteinID: XP_006344039
UniProt: M0ZYE1
Position
Un
AA seq 604 aa AA seqDB search
MDFVYKNPSALIEERVQDLLSRMTLEEKIGQMAQIERSVATPSVITDLSIGSILSVGGSA
PFEDAPSEAWADMVDRFQKAALESRLGIPLLYGVDAIHGNNNVYGATIFPQNVGLGATRD
ADLVQKIGIVTALEVRACGINYTFAPCVAVCRDPRWGRCYESYGEDTELIRKMTSIVTGL
QGQPPPGYPQNYPFLAGRDKVVACAKHFVGDGGTDRGINEGNTISSYDDLERIHIAPYID
CISQGVCTVMASYSKWNGSHLHSSHFLLTEVLKGKLGFKGFVISDSEGLDRFFHPHGSNY
DQSILAAINAGIDMVMVPFRYQLFLDHLKYLVESGEIRMTRIDDAVERILRVKFVSGAFE
NPLSDRSLLDTVGCNQHRELAREAVRKSLVLLKNGKDVTKPFLPLDRKAKRILVAGKHAD
DLGFQCGGWTKTWKGMGGRITIGTTILEAIKDAVRGETELVYEENPSPDTFAIQDFSYSI
VVVGEPPYCESGGDSQDLRIPLGGEELISLVAGRVPTLVILISGRPLYIEPSILEKMEAF
VAAWLPGTEGTGITDVIFGDFEFHGRLPMTWFKSVDQLPLHQEQNSYEPLFSFGYGLTSK
NKVL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggattttgtgtataagaacccatcagctcttattgaggaaagagtacaagatttgtta
tctcggatgacacttgaagaaaaaataggccaaatggctcagattgaacgcagtgttgct
accccctctgtcattactgacctttctatagggagtatactcagtgttggaggcagtgca
ccatttgaggatgccccatcggaagcttgggcagatatggttgacagatttcaaaaggct
gcgctggaatcacggcttgggattccgcttctttatggagttgacgctattcatggcaat
aacaatgtttatggtgctaccatttttccacaaaatgtgggccttggagccaccagagat
gcagatttggttcagaagattgggattgtgactgctcttgaagtcagggcttgtggcatt
aactatacttttgctccctgtgttgctgtatgtagagatcccaggtggggaagatgctat
gagagttatggagaagacaccgaacttattaggaagatgacctcaattgtcacaggcttg
caagggcaaccacctcctggatacccccaaaactatccttttctagctggaagagacaag
gttgttgcctgtgcaaagcactttgttggagatgggggtactgaccgaggtataaatgag
ggaaataccatatcatcgtatgatgatctagagagaatacatattgccccttatattgac
tgtatttctcagggagtttgcacagtaatggcatcctactctaaatggaatggaagccac
ctgcattctagccactttcttcttactgaagttttgaaagggaagctcggatttaagggc
tttgttatttctgattccgaaggacttgaccgatttttccatcctcatggatctaactat
gaccaaagtattttggcagcaattaatgcagggattgacatggtgatggttccttttcgg
tatcaattatttctcgatcatttgaaatatcttgtggaatctggggagattcgaatgacc
agaattgatgatgctgttgaaaggatcctgagagttaagtttgtttccggagcttttgag
aaccctttgagtgataggtcattgttggatactgttggttgtaatcaacatcgtgaatta
gcacgtgaagcagttcgcaaatcactggttcttctaaagaatgggaaggatgtaacaaaa
ccatttcttccgctagatagaaaggcaaagagaattcttgtagcaggaaaacatgctgat
gaccttggatttcaatgcggagggtggactaaaacatggaaaggaatgggcggaagaatc
acgattggtacaactattctggaagctattaaagatgctgttagaggggaaacagaactg
gtatatgaggaaaatccgtcaccagacacctttgcaattcaagacttctcttattccatt
gtagttgttggtgaacctccctattgcgaaagcggtggagacagccaagacctcagaatt
cctcttggcggagaagaactaataagcttggttgcaggcagagttccaacattggtgata
ttgatctccggaaggcctttatatatagagccttcgattctggagaaaatggaggccttt
gttgctgcatggttaccgggtaccgagggaactggtatcactgatgtcattttcggagat
tttgaattccatggaaggctccctatgacatggtttaaaagtgtagatcaattacccctg
catcaagaacagaactcctatgaacctctcttttcattcggctacggattaactagtaaa
aacaaggtgctctag

DBGET integrated database retrieval system