KEGG   Solanum tuberosum (potato): 102593657Help
Entry
102593657         CDS       T02981                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    102593657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 102593657
NCBI-ProteinID: XP_006364657
UniProt: M1C493
Position
Un
AA seq 660 aa AA seqDB search
MVRLRSILLFLLLFKSFGSIIAEEEDQIEQFSEALLLRPLPDRKVLAHFHFESKVPPTRT
HGSHHHLFPKSIYQLVHKFRVREMELSFTQGRWNYARWGGHDPISSRNAKPPGVELWATF
DVPQHQVDASWRNLTHALSGLFCASINFLESSTAYSSPQWSFKSFATNIRYGTLPREAVC
TENLTPWLKLLPCRDKAGLSALMDRPSIYRGFYHSQRLHLVSNEFDLAAASSGMVLEQTL
TVVLQPVTLGSGMTSSVAIQQPSWSLSSLFGRKVSGRCVLSNASNVYVQLEPDLVSELKT
ISETQQQSDVENLIAQAWSDTSFEMSESAVRVIQEANGFQKESSLLYEFSLENFSDSKPF
DLEFRWKRPVTWSSQLAPLQARRFLMGSGNERGAIAISLKSVGRSEYAKSSVNEEGRCSL
RVDLFQVVPWYVKVYYHTLKVFLDERLHSLADVVERTNVSPSEDKVSPGLMEIALRLPCD
VHSVILTLEFDKGFLHIDEYPPDANQGFDIPSALIRFPEIKTKMHLFEDKSACKSPILSK
LQEESPVLWYTEVLLVPLTTPDFSMPYNVITITCTVFALYFGSLLNALRRRVEEEERLLK
SKAAMPSGPIGVLLSKLSAKLRGKPLEPPPPSSSSKVSYKLILRVILVAGIAAAWQYFYG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggttcggttaagatcaattttgctttttcttctgctctttaagagtttcgggtcaatt
attgccgaagaggaagatcaaattgaacagttctcggaagcactcttgttgaggccattg
ccagatcgtaaagtgcttgcccattttcatttcgaaagtaaagtcccaccaactcgaaca
catggcagccaccaccatcttttccccaaatccatttatcagctggtccataaatttaga
gttcgagaaatggagctgtcgttcacacaaggtcgctggaattatgcacgctggggtgga
catgatcccatttcaagtagaaatgcgaagcctcctggagttgaactgtgggctactttt
gatgttccacaacatcaggtcgacgcttcatggagaaatttaacacatgctctttcaggg
ctcttttgtgcttctattaacttcctagagtcatcaactgcttattcttctccccaatgg
agcttcaagtcatttgctacaaatatcaggtacggcaccttgccccgtgaggctgtttgc
acagagaacctcactccttggctaaagttgcttccttgccgagacaaagctggactttct
gcattgatggacagaccttctatctaccgaggattttatcactctcagaggttgcattta
gtctcaaatgaatttgatctagctgcagcaagttctggaatggtgcttgaacagacactt
actgttgttctccaaccggttactttaggaagtggcatgacatcatctgttgcaatacag
caaccaagttggtcactgagctcattgtttggacggaaagttagtggaaggtgtgttctt
tcaaatgctagtaatgtgtatgtccaattagagccagatttggtgtctgaattgaagact
atttcagagacgcaacaacaatctgatgttgagaatttgattgctcaagcttggagtgac
acgagctttgaaatgtctgagtctgcagtcagggtaattcaagaagccaatggctttcag
aaggagtcatcccttctgtatgaattttctctagaaaattttagtgattcaaagccattc
gacttggagttcaggtggaagcgtcccgtgacatggtcatctcaactggcacccttgcag
gctcgcaggttccttatgggaagtgggaatgaaaggggtgccatagccatctccttgaag
tctgtaggaagaagtgagtatgcaaaatcttctgtcaacgaggaaggaagatgctcgtta
cgggttgatctgttccaagttgtgccttggtatgtcaaggtttattaccacacgcttaaa
gtgtttctagatgaacgtcttcacagtttagcagatgttgtagaaaggacaaatgtttcg
ccttctgaagacaaggtttctcctgggctaatggaaatagcattgcgattgccatgtgat
gtgcactcggtgatattgacattggagtttgataagggttttctgcacatcgatgagtat
cctccagatgctaaccagggatttgacattccatcagctttaatcaggtttcctgagatc
aaaacaaagatgcatttatttgaggataaatctgcttgcaagtcacctatcttatccaag
ctacaggaagaaagccctgttctatggtacacagaagtattgcttgtacccttgaccact
cctgattttagcatgccatacaatgttatcacaattacgtgcactgtatttgctctatat
tttggatcactgcttaatgcgttacgtaggcgtgttgaagaggaggagaggcttctgaaa
agtaaagctgccatgcccagtggtccgataggcgtgctactgtccaagttatcagctaaa
ttgagaggaaaaccgttggaaccaccacccccatcctcttcatctaaagtcagttataag
ctgattctcagagtgatactggtggctggtattgctgctgcttggcagtacttctatgga
tga

DBGET integrated database retrieval system