KEGG   Solanum tuberosum (potato): 102594017Help
Entry
102594017         CDS       T02981                                 

Definition
(RefSeq) pyruvate, phosphate dikinase regulatory protein 1, chloroplastic
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
sot  Solanum tuberosum (potato)
Brite
KEGG Orthology (KO) [BR:sot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102594017
Enzymes [BR:sot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     102594017
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     102594017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 102594017
NCBI-ProteinID: XP_006352601
UniProt: M1ASN6
Position
Un
AA seq 394 aa AA seqDB search
MICSSSLRLSGSGTGTRNSPSPPASSENSDESQSQVRRIKASPQLNRWSRARSIRSGRKL
DRSAVSYTESRDKSGSPEIELPMSPKGDSRSGSSDDEKEVNGGKPIFMVSDGTGWTAEHA
VNAALGQFDYCLVDRVCPVNTHLFSGIDDVEKLMEIVKQAAKEGAMVVFTLAEPSMAQFA
KQACQHWGVASSDILGPITEAIAGHLGVSPSGLSRWAPERQKSPLSEEYFRRIEAIEFTI
KQDDGALPRNLHMADIVLTGVSRSGKTPLSIYLAQKGYKVANVPIVMNIDLPNTLFEVNP
EKVFALTINPVVLQSIRRARAKTLGMDGELKTNYCDMDYVKEELEYAGKIFAQNPVWPVI
EVTSKAIEETAVIVLRLYHDRKNRCSMPRISKRY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatttgttcttctagcctacgcttgtccggttccggcaccggcaccagaaacagtcca
tctccaccggcgagttctgaaaattccgatgaatctcagtcgcaggtgcgaaggattaaa
gccagccctcagctaaaccggtggtccagagctcgaagcatccggtccggcaggaaacta
gaccggtctgctgttagttacactgaatcacgcgacaagtccggttcaccggaaattgag
ttgcctatgtctcctaaaggtgatagccggtccggctcgtcagacgatgaaaaagaggtt
aacggaggaaaaccgatatttatggtgtctgatggaactggatggacggcggagcacgcc
gttaacgcagctttaggacaatttgattattgcttagtcgatcgcgtttgccctgtgaat
actcacttgttctctgggattgatgatgttgaaaaattaatggagatagtgaagcaagca
gccaaagaaggggcaatggttgtctttactttagctgagccttccatggctcaatttgcc
aaacaagcatgtcaacactggggtgtagcatctagtgatatactggggccaattacagag
gcaattgctggccatcttggtgtttcaccttctggcctctctcgttgggctcctgagagg
cagaaatctcctctcagcgaggaatacttccggaggattgaagcaattgaatttaccata
aagcaagatgatggtgccttgccgcgaaacctgcatatggcggatatagttctaaccggt
gtttcacgaagtgggaagacaccgctatctatttatttagcacagaaaggatataaagta
gctaatgtacccattgtcatgaatatagacttacccaatacactgtttgaagttaacccc
gaaaaggtttttgctttgacaataaatcccgttgttctgcaatccatcagaagagcaaga
gctaagactctgggtatggatggagaactgaagaccaactattgtgacatggattacgtg
aaagaagagttggaatatgcagggaaaatttttgcgcaaaaccctgtctggccagtaata
gaagttacgtctaaagctattgaagaaacagctgttattgttctgagactttaccacgac
agaaagaacaggtgttcaatgccaagaatttccaaacgctattaa

DBGET integrated database retrieval system