KEGG   Solanum tuberosum (potato): 102594883Help
Entry
102594883         CDS       T02981                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03040  Spliceosome
sot04141  Protein processing in endoplasmic reticulum
sot04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102594883
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102594883
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102594883
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sot01009]
    102594883
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sot03041]
    102594883
   03009 Ribosome biogenesis [BR:sot03009]
    102594883
   03110 Chaperones and folding catalysts [BR:sot03110]
    102594883
   04131 Membrane trafficking [BR:sot04131]
    102594883
   03051 Proteasome [BR:sot03051]
    102594883
   03029 Mitochondrial biogenesis [BR:sot03029]
    102594883
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sot04147]
    102594883
Protein phosphatases and associated proteins [BR:sot01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102594883
Spliceosome [BR:sot03041]
 Complex B
  Other components
   Prp19 complex
    102594883
 Complex C
   Prp19-CDC5 complex
    102594883
Ribosome biogenesis [BR:sot03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102594883
Chaperones and folding catalysts [BR:sot03110]
 Heat shock proteins
  HSP70 / DNAK
   102594883
Membrane trafficking [BR:sot04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102594883
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102594883
Proteasome [BR:sot03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102594883
Mitochondrial biogenesis [BR:sot03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102594883
Exosome [BR:sot04147]
 Exosomal proteins
  Proteins found in most exosomes
   102594883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C Zincin_2
Motif
Other DBs
NCBI-GeneID: 102594883
NCBI-ProteinID: XP_006349004
UniProt: M0ZI18
Position
Un
AA seq 652 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA
EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKSTSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEEKNMDLFRKCMEPVEKCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKK
KVEAKNGLENYAYNMRNTIKDDKVSSQLPAADKKKIEDAIDEAIKWLDSNQLAEADEFED
KMKELESVCNPIIAKMYQGGAGGATMDEDDGPSVGGGAGSGSGAGPKIEEVD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaaggtgaagggccagcaattggaattgatttgggtactacatattcttgt
gtaggtgtatggcaacatgatcgtgttgaaattatagcgaatgatcaaggcaacagaacc
acgccctcttatgttgcttttactgatactgaacgcctcattggtgatgctgccaagaat
caagtcgctatgaacccagttaacactgtattcgatgctaagcgtttaattggaaggaga
tttagtgatccttcagtgcaaagcgatatgaaactatggccttttaaggttatacccggg
cctgctgacaagccaatgattgttgttacatacaagggtgaggagaagcaattttctgct
gaggaaatctcatccatggtcttaaccaaaatgaaggagattgctgaggcataccttggg
acaacaatcaagaatgcggtcgtcacagtccctgcttacttcaatgattctcagcgtcag
gcaactaaggatgctggtgtcatatctggtcttaatgtgatgcgtataatcaacgaacca
acagctgctgcaattgcctatggacttgacaaaaagtctactagtactggtgagaaaaat
gtgttgattttcgatttaggtggtggtacttttgatgtgtctcttctcactattgaagag
gggatctttgaggttaaagctactgctggtgatactcacttgggaggtgaggattttgat
aatagaatggtgaatcatttcgttcaagagttcaagaggaagcataagaaggatattagt
gggaatccgagagcgttgaggaggttaaggactgcttgtgagagagcaaagaggacttta
tcatccactgctcaaactacaattgaaatcgattccttgtatgaagggattgacttttac
acaaccatcacaagggcaagattcgaggagaagaacatggatttgttcaggaagtgtatg
gagcctgtggagaagtgtttgagagatgctaagatggataaaagcggcgttcatgatgtg
gttcttgttggtggatcaactaggatcccgaaagttcaacaattacttcaggactttttc
aatgggaaggagctttgtaagagtatcaaccccgatgaagcagttgcttatggtgcagct
gtgcaagctgcaattttgagcggtgaaggcaacgagaaggttcaagacttgttgctgttg
gatgtcactcctctgtcgctcggtttagaaactgctggaggtgtaatgactgtgttgatt
ccaaggaatacaaccattccaaccaagaaagagcaagttttctctacatactcagacaac
caacccggtgtcctgatccaggtatacgaaggagaaagagcgaggaccaaggacaacaac
ctgttaggcaagtttgaactctctggcatcccacctgcaccaaggggtgttcctcaaatc
aatgtctgcttcgacattgatgccaatggaatcctgaatgtctccgcggaggacaaaact
actggacagaagaacaagataactatcaccaacgacaagggtcgactatccaaggaagaa
attgagagaatggtgcaagaagctgagaagtacaagtctgaagatgaagagctcaagaaa
aaggtggaagctaagaatggattggagaattacgcttacaacatgaggaacactattaaa
gatgacaaggttagttcccaacttccagctgctgataagaagaagattgaggacgcgatc
gatgaagctatcaagtggttagacagtaaccaacttgcagaagctgatgagtttgaagac
aagatgaaggaactggaaagcgtatgcaatccgattattgccaagatgtatcaaggtggt
gccggtggagctactatggatgaagatgatggtccttctgttggtggtggtgcaggaagt
ggaagtggtgctggaccaaagattgaggaagtggattag

DBGET integrated database retrieval system