KEGG   Solanum tuberosum (potato): 102595065Help
Entry
102595065         CDS       T02981                                 

Definition
(RefSeq) 50S ribosomal protein L22-like
  KO
K02890  large subunit ribosomal protein L22
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    102595065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sot03011]
    102595065
Ribosome [BR:sot03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    102595065
  Bacteria
    102595065
  Archaea
    102595065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 RelE
Motif
Other DBs
NCBI-GeneID: 102595065
NCBI-ProteinID: XP_015170928
Position
Un
AA seq 267 aa AA seqDB search
MVSEDLPLVRCLIYQACGIHFHLASEGHCTNIYNIWLSSSRTLLADDATLVSSPLTPLLT
SSTSSTEAEKAISKPSKVQAVLKGIKQSPKKVNLVAALVRGMRVEDALLQLQVTVKRASK
TIYQAIHSARANAVHNHGFDPDRLLVGKMTNKNFTYFHLISNLLEYFILIMLGATEAFLG
KRLFKKRLSYHAKGKCGLMVRPECRLTVVLREITPAEEAEIAKLRVRNFKKLTKREKRLV
PHKLIETTPIWNRKGKVRSSGTGAVAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtatccgaagatctgcctttggtgaggtgccttatttaccaagcctgcggaatacac
tttcacctagcatctgaaggccattgtaccaatatctacaacatttggttgtctagttca
aggacattacttgcagatgatgcaacactagtttcttctccattaacaccactgttaaca
tcaagtacttccagtacagaagcagagaaagcaatttctaaaccttcaaaagttcaagca
gttttgaagggtataaaacagagcccaaagaaggtgaatttggttgctgcattagttcgt
ggcatgcgcgttgaagatgcattgttacagttgcaagtgacagtaaagcgagcttccaaa
actatctatcaggctatacactcagctagggcaaatgcagtgcataaccatggatttgat
ccggatcgtcttcttgttggtaaaatgacaaacaaaaactttacatattttcatctcatt
tcgaaccttttggagtacttcatccttatcatgcttggtgcaaccgaggcatttcttgga
aagagacttttcaagaaaaggctgtcctaccatgctaaaggaaagtgtggactgatggta
aggccagaatgtagattgacagtggtacttagggagataacaccagcggaggaggccgag
atagctaaattgagagtaaggaacttcaaaaagctaaccaaacgcgaaaaacgtcttgtc
cctcataagctcattgagactactccaatatggaaccgcaagggcaaagttagaagtagt
ggcacaggtgctgttgctgaatga

DBGET integrated database retrieval system