KEGG   Solanum tuberosum (potato): 102595219Help
Entry
102595219         CDS       T02981                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03040  Spliceosome
sot04141  Protein processing in endoplasmic reticulum
sot04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102595219
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102595219
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102595219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 102595219
NCBI-ProteinID: XP_006349005
UniProt: M0ZI19
Position
Un
AA seq 652 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA
EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKSTSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKK
KVEAKNGLENYAYNMRNTIKDDKVSSQLPGADKKKIEDAIDETIKWLDSNQLAEADEFED
KMKELESVCNPIIAKMYQGGAGGATMDEDDGPSVGGGAGSGSGAGPKIEEVD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaaggtgaagggccagcaattggaattgatttgggtactacatattcttgt
gtaggtgtatggcaacatgatcgtgttgaaattatagctaatgatcaaggcaacagaacc
acaccctcttatgttgcttttactgataccgaacggttgattggtgatgctgcgaagaat
caagtagctatgaacccagttaatactgtattcgatgctaagcgtttaattggaaggaga
tttagcgatccttcagtgcagagcgatatgaaattatggccatttaaggttatacccggg
cctgctgacaagccaatgattgttgttacatacaagggtgaggagaagcaattttctgct
gaggaaatctcatccatggtcttaaccaaaatgaaggagattgctgaggcataccttggg
acaacaatcaagaatgcggtcgtcacagtccctgcttacttcaatgattcgcagcgtcag
gcaactaaagatgctggtgtcatatctggtcttaatgtgatgcgtataatcaacgaacca
acagcagctgcaattgcctatggacttgacaagaagtctactagtactggtgagaaaaat
gtgttgattttcgatttaggtggtggtacttttgatgtgtctcttctcactattgaagag
gggatctttgaggttaaagctactgctggtgatactcacttgggaggtgaggattttgat
aatagaatggtgaatcattttgttcaagagtttaagaggaagcataagaaggatattagt
gggaatccgagagcattgaggaggttaagaactgcttgtgaaagagcaaagaggacttta
tcatccactgcccaaacaacaattgaaatcgattcgttgtatgaaggaatcgatttttac
acaactatcactagggcaagatttgaggagatgaacatggatttgttcaggaagtgtatg
gagcctgtggagaagtgtttgagagatgctaagatggataaaagcggcgttcatgatgtg
gttcttgttggtggatcaactaggatcccgaaagttcaacaattacttcaggactttttc
aatgggaaggagctttgtaagagtatcaaccccgatgaagcagttgcttatggtgctgct
gtgcaagctgcaatcttgagcggtgaaggcaatgagaaggttcaagatttgttgctgttg
gatgttactcctctgtcactcggtttagaaactgctggaggtgtaatgactgtgttgatt
ccaagaaatacaaccattccaaccaagaaagagcaagttttctctacatactcagacaac
caacccggtgtcctgatccaggtatacgaaggagaaagagcgaggaccaaggacaacaac
ctgttaggcaagtttgaactctctggcatcccacctgcaccaaggggtgttcctcaaatc
aatgtctgcttcgacattgatgccaatggaatcctgaatgtctccgcggaggacaaaaca
acagggcagaagaacaagataactatcaccaacgacaagggtcggctctccaaggaagag
attgagagaatggtgcaagaagctgagaagtacaagtctgaagatgaagagctcaagaaa
aaggtggaagctaagaatggattggagaattacgcttacaacatgaggaacactattaaa
gatgacaaggttagttcccaacttccaggtgctgataagaagaagattgaggacgcgatc
gatgaaactatcaagtggttagacagtaaccaacttgcagaggctgatgagtttgaagac
aagatgaaggaactggaaagcgtatgcaatccgattattgccaagatgtatcaaggtggt
gccggtggagctactatggatgaagatgatggtccttctgttggtggtggtgcaggaagt
ggaagtggtgctggaccaaaaattgaggaagtggattaa

DBGET integrated database retrieval system