KEGG   Solanum tuberosum (potato): 102595277
Entry
102595277         CDS       T02981                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00100  Steroid biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Module
sot_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102595277
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102595277
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 102595277
NCBI-ProteinID: XP_006341170
UniProt: M0ZSD2
Position
Un
AA seq 369 aa
MDLNYLFISLTPSWTSVAMLIGYFLYLATVGSILPGKLVPGATLSDGTRLHYRCNGLLSL
LLLVLLLGVGSQMNLVSPTAIADRGLELLSTTFIFSVLVTLMLYLVGLNSRAKSSSLKPH
VSGNLIHDWWFGIQLNPEFMGIDLKFFFVRAGMMGWLLINLSVLAKCVIEAKLSQSMILY
QLFCGLYILDYFFYEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFSIQGWWLLSNNVELT
TAAIIANCLVFLIGYSVFRGANKQKHVFKKDPKAPIWGSPPKVIGGKLLASGYWGIARHC
NYLGDLLLASSFSLPCGISSVVPYFYPIYLLILLIWRERRDEARCAEKYKDVWAEYRKLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaattatctcttcatttctctcactccatcatggacttcggttgctatgttg
atcggttattttctctatttagctaccgttggatctattctacccggaaaacttgttcct
ggggcgactttatctgatggaactcgactacattatcgttgcaatggtttgttatcactt
ctgttgttggttttgcttcttggagttgggtcgcagatgaatcttgtttcacctactgct
atagcagatagaggacttgagcttttgtccacaacatttatctttagtgttcttgtgaca
ttgatgctttatttggttggcctgaactcacgtgcaaagagttcatcactgaaacctcat
gtctcaggaaatctaatccatgactggtggtttgggatacaactgaatcctgaattcatg
ggcattgatctcaaatttttctttgttagagctggtatgatgggatggttattaatcaat
ctttcagttcttgcaaaatgtgttatagaggctaaattaagccaatcaatgattctctac
cagctattttgtgggctctacatccttgactacttcttctatgaagagttcatgacctcc
acatgggatataatagcagagaggttgggcttcatgctggtttttggtgatctagtcttt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacaacgtggagctaaca
acagcggcaataattgccaattgcctcgtctttcttattgggtactcggtgttcagagga
gccaataagcagaagcatgtatttaaaaaggatcccaaggcaccaatatggggtagtcct
ccaaaagttattggggggaagttgcttgcttctggctattggggcattgcacggcactgt
aattacctcggggacttgttactggcatcgtcttttagtttaccttgtggtataagctct
gtggttccatacttttaccccatatatcttctcattctactcatatggagggagagaagg
gacgaagctagatgtgcggagaagtacaaagacgtgtgggctgaataccgtaaacttgtt
ccttacaggatcttaccttatgtttactag

DBGET integrated database retrieval system