KEGG   Solanum tuberosum (potato): 102595776Help
Entry
102595776         CDS       T02981                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 4-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00520  Amino sugar and nucleotide sugar metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102595776
Enzymes [BR:sot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     102595776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 102595776
NCBI-ProteinID: XP_006349950
Position
Un
AA seq 385 aa AA seqDB search
MSIAICSVVSISSTILKSDFETINIQDTFISSNPIPRRIAYELVDETDHANAGGKVPLGL
KGKSKRILVTGGAGFVGSHLVDRLIARGDSVIVIDNFFTGKKENLLHHFKNPRFELIRHD
VVEPILLEVDQIYHLACPASPVHYKFNPVKTIKTNVMGTMNMLGLAKRVGARFLITSTSE
VYGDPLQHPQAETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGLNIEVRIARIFNTYGP
RMCIDDGRVVSNFVAQALRKEPMTVYGDGKQTRSFQFVSDLVEGLMRLMEGNHVGPFNLG
NPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPDITKAKQLLGWEPAVSLRQGL
PMMVDDFRQRIFGDDKQDSANLLTI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgccatttgctctgtagtttctatttcttctacaatattaaaatccgatttc
gaaacgattaatattcaagatacatttatatcgagtaatccgatccctcgaagaattgcg
tatgagttggttgatgaaaccgaccacgctaatgcaggtggaaaggttccattgggattg
aagggaaagagtaagagaatattagtaacaggaggagcaggatttgttgggagccatttg
gtggatagattaatagcaagaggagatagtgttattgttattgataatttttttacaggt
aaaaaagagaatttgttgcaccatttcaagaatccaagatttgaacttattcgacacgac
gtcgttgagccgattttgttagaagttgatcaaatttatcatctagcttgccctgcttct
cctgttcattacaagtttaatccagtcaagactatcaaaacaaatgtgatgggaacaatg
aatatgttgggattagcaaaaagagttggagctagatttcttattactagcacaagtgaa
gtttatggtgatccattgcaacatcctcaagctgagacttattggggcaatgttaatccc
attggtgtccgcagttgttatgatgaaggaaaacgtacagctgaaactttgaccatggat
taccatagaggactcaacattgaggttagaattgctaggattttcaacacatatggacca
cgtatgtgcatagatgatggtcgtgttgttagcaattttgttgcacaggctttaagaaag
gagccaatgacagtttatggagatggaaaacaaaccaggagctttcaatttgtctctgat
ttggttgaaggtttgatgaggttgatggaaggaaatcatgtaggtcctttcaatcttggg
aatcctggtgaattcaccatgcttgaactagctaaggtggtgcaagaaacaatagatcca
aatgcaaaaatagaatttaggcccaacacagaagatgatccacacaagagaaagccagat
attacaaaagcaaaacagcttctaggatgggagccagcagtttctctccggcaaggactt
ccgatgatggttgatgacttccggcaacggattttcggcgacgacaagcaagattccgcc
aacttattaaccatataa

DBGET integrated database retrieval system