KEGG   Solanum tuberosum (potato): 102600847Help
Entry
102600847         CDS       T02981                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1-like
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00071  Fatty acid degradation
sot00072  Synthesis and degradation of ketone bodies
sot00280  Valine, leucine and isoleucine degradation
sot00310  Lysine degradation
sot00380  Tryptophan metabolism
sot00620  Pyruvate metabolism
sot00630  Glyoxylate and dicarboxylate metabolism
sot00640  Propanoate metabolism
sot00650  Butanoate metabolism
sot00900  Terpenoid backbone biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01200  Carbon metabolism
sot01212  Fatty acid metabolism
Module
sot_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    102600847
   00630 Glyoxylate and dicarboxylate metabolism
    102600847
   00640 Propanoate metabolism
    102600847
   00650 Butanoate metabolism
    102600847
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102600847
   00072 Synthesis and degradation of ketone bodies
    102600847
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102600847
   00310 Lysine degradation
    102600847
   00380 Tryptophan metabolism
    102600847
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102600847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sot04147]
    102600847
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     102600847
Exosome [BR:sot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102600847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 102600847
NCBI-ProteinID: XP_015169006
UniProt: M1BGN4
Position
Un
AA seq 404 aa AA seqDB search
MAPAAADTIKPRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE
VFFGNVLSANLGQAPARQAALGAGLPNTVVCTTVNKVCASGLKATMLAAQSIQLGINEVV
VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGMLKDGLTDVYKDCGMGVCAETCAANHKI
TREEQDDYAVQSFERGIAAQEAGAFAWEIVPVEVPGGRGKPSIIVDKDDGLGKFDGAKLR
KLRPSFKDKDGTVTAGNASSISDGAAALVLVSGEKAIKLGLNVIGKISGYADAAQEPELF
TTAPALAIPKAIKSASLEASQIDYYEINEAFAVVSLANQKLLGLNPEKVNVHGGAVSLGH
PLGCSGARILVTLLGVLRQKNGKYGAAGVCNGGGGASALVLELV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctccagcagcagcagataccatcaagcctagagatgtttgcattgttggtgttgcc
cgtactccaatggggagcttccttggttctctttcctcgttgccagctacaaaacttgga
tcaatagccattgagggtgctcttaagaaagcaaatgttgatccatcactagtagaagaa
gtcttctttggaaatgtcctcagtgcaaacctgggacaggctcctgctaggcaagctgca
ttgggtgcaggactacccaatacggtggtttgcacgactgtgaacaaagtttgtgcatct
ggcttgaaagctactatgcttgcagctcaaagtatccagttgggcatcaatgaggtggtt
gtggctggtggaatggaaagcatgtccaatgttcccaaatatattgcagaagcaaggaag
ggatctcgtcttggacatgatagtctagttgatggaatgcttaaagatggtttgactgat
gtttataaggattgtggtatgggagtttgtgcagaaacatgtgctgcaaatcataaaatt
acaagagaggagcaggatgattatgcagttcaaagttttgaacgtggaattgctgctcag
gaagctggtgctttcgcatgggagattgtaccggttgaggtgcctggaggaagaggaaag
ccatccattattgttgataaggatgacggtctaggaaagtttgatggtgcaaaattgaga
aaactccgaccaagttttaaggataaagatggtactgttactgctggtaacgcttctagc
ataagtgatggtgctgctgcattggtcttagtaagtggagagaaggctataaaactagga
ttaaatgttattggaaagatctcaggctacgcggatgctgctcaggaacctgaattattc
acaactgcacctgctctagcaattcccaaagctatcaaaagtgctagcttagaggcttct
caaattgattactatgaaataaatgaagcctttgctgtggtatctcttgcaaatcaaaag
ctgcttggtcttaatccagaaaaagttaatgtacacggtggggctgtatctttggggcat
cctcttggatgcagtggagctcgtatattggttacacttctcggggtgttgagacagaaa
aatggcaaatatggagctgctggtgtttgcaatggaggaggaggtgcctcagcccttgtc
ctagagcttgtgtaa

DBGET integrated database retrieval system