KEGG   Solanum tuberosum (potato): 102601328Help
Entry
102601328         CDS       T02981                                 

Gene name
PK, PKc
Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00010  Glycolysis / Gluconeogenesis
sot00230  Purine metabolism
sot00620  Pyruvate metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01200  Carbon metabolism
sot01230  Biosynthesis of amino acids
Module
sot_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sot_M00002  Glycolysis, core module involving three-carbon compounds
sot_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sot_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102601328 (PK)
   00620 Pyruvate metabolism
    102601328 (PK)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102601328 (PK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sot04131]
    102601328 (PK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sot04147]
    102601328 (PK)
Enzymes [BR:sot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     102601328 (PK)
Membrane trafficking [BR:sot04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102601328 (PK)
Exosome [BR:sot04147]
 Exosomal proteins
  Proteins found in most exosomes
   102601328 (PK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 102601328
NCBI-ProteinID: NP_001275085
UniProt: P22200
Position
Un
AA seq 510 aa AA seqDB search
MANIDIAGIMKDLPNDGRIPKTKIVCTLGPSSRTVPMLEKLLRAGMNVARFNFSHGTHEY
HQETLDNLKIAMQNTQILCAVMLDTKGPEIRTGFLTDGKPIQLKEGQEITVSTDYTIKGN
EEMISMSYKKLVMDLKPGNTILCADGTITLTVLSCDPPSGTVRCRCENTATLGERKNVNL
PGVVVDLPTLTEKDKEDILEWGVPNNIDMIALSFVRKGSDLVNVRKVLGPHAKRIQLMSK
VENQEGVINFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKAVVTATQM
LESMIKSPAPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMSRICIEAESSLD
NEAIFKEMIRCTPLPMSPLESLASSAVRTANKARAKLIVVLTRGGSTAKLVAKYRPAVPI
LSVVVPVLTTDSFDWSISDETPARHSLVYRGLIPLLGEGSAKATDSESTEVILEAALKSA
VTRGLCKPGDAVVALHRIGSASVIKICVVK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatagacatagctggaatcatgaaggatctcccaaatgatggccgtattcca
aagaccaagattgtttgcacgttagggccatcttctagaacagtgccaatgctggagaag
cttctccgtgctggcatgaacgttgccaggtttaacttttctcatgggacccatgagtac
catcaggagacattggacaatcttaagattgctatgcagaatactcagatcctgtgtgct
gtcatgcttgacaccaaggggcctgagattcgtactggtttcttaacagatggaaaaccg
attcagcttaaggaaggtcaagaaatcactgtatccacagactataccataaaaggaaat
gaagaaatgatctcaatgagctataagaagttggtaatggacttgaagcccggcaatacc
attttgtgtgcagatggtaccataacccttactgttttgtcatgtgatccaccgtctgga
acggtgagatgtcgctgcgagaatactgccaccttaggagagaggaagaatgtaaacctt
ccaggtgtggttgtggaccttccaacacttacagagaaggataaagaagatatactagag
tggggtgttcctaacaacattgatatgatagcgctttcgtttgtgcgtaagggttcagat
cttgtcaatgttcgcaaggttcttggtccacatgccaagcgcattcaactaatgtcaaag
gttgaaaaccaagaaggggtaatcaactttgatgaaatccttcgtgagacagattctttt
atggttgctcgaggtgatctcggaatggaaattccagttgagaagattttcttggctcag
aaaatgatgatatacaagtgtaatcttgctggcaaagctgtggtaactgccactcagatg
cttgaatcaatgatcaagtctccagcacccacccgtgctgaggctactgatgtggctaat
gctgtcttggatggcactgattgtgttatgttaagtggggagagtgcagctggtgcttat
cctgagctggcagtaaaaatcatgtcacgaatctgcattgaggcagagtcttcacttgac
aacgaggctatcttcaaggaaatgatcaggtgtaccccactgccaatgagcccattggag
agtcttgcatcatcagctgtccgtacggctaacaaagctagagcaaaactcattgttgtc
ctgacacgtggcgggagtacagcaaagctggttgccaagtataggcctgcagttcctatt
ctgtcagtagtcgtgcctgttttgaccacagactctttcgattggtccatcagcgacgag
accccagctagacacagtttggtatataggggcttgattccacttcttggtgaaggttct
gcaaaggccactgattctgaatcaactgaggtaatccttgaagcggccctgaagtctgcc
gtaacgagagggctatgcaaacctggtgatgctgtcgtggcacttcatcgtattggttct
gcatccgttatcaagatttgcgtcgtgaagtaa

DBGET integrated database retrieval system