KEGG   Solanum tuberosum (potato): 102604882Help
Entry
102604882         CDS       T02981                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
sot  Solanum tuberosum (potato)
Brite
KEGG Orthology (KO) [BR:sot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102604882
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102604882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 102604882
NCBI-ProteinID: XP_006338052
UniProt: M1AJK1
Position
Un
AA seq 686 aa AA seqDB search
MESSSELLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPK
SLHVEPEEETELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA
DDDIYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGAWLQNLSYGVFALGN
RQYEHFNKIGKVIDEQMSEQGAKRLVPVGLGDDDQCIEDDFAAWREQLWPELDQILRDED
DANSAATPYTAAIPEYRLVIHDTTMSLEDKHAGMANGNTTYDIHHPCKVNVAVQRELHTP
ESDRSCIHLEFDISGTGISYETGDHVGVYAENSEDTVEEAARLLGQSLDLIFSIHTDKED
GTAGGGSLPPPFPGPCTLRAALARYADLLNPPRKATLVALATHAAEPSEAEKLKFLASPQ
GKDEYSQWIVASQRSLIEVMSEFPSAKPPLGVFFAAVAPRLQPRYYSISSSPRFAPARVH
VTSALVYGPTPTGRIHKGVCSTWMKNAVPLEKSHNCSSAPIFIRPSNFKLPADPSIPIVM
VGPGTGLAPFRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISE
LIIAFSREGPQKEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQ
ENADSSKAEAVVKKLQMDGRYLRDVW
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagttcggagttgctgagatcgattgaatcggcattgggagtatcgttgggg
agcgatacggtgttggtgctacttacgacgtcgttcgcggtcatcgttgggttagtagtg
ttcttcttgaagagatcaagtgatcggagtaaagaagtgaagcctgtggtgttccctaag
tccttacatgtggagccggaagaggagactgagctagaacctggaaaagttaaggtcacc
gtgttttttggtactcaaactggtactgctgagggttttgccaaggctttatcagaggag
ataaaagcaagatatgagaaggcagttgtgaaagttgtagacatggatgattatgctgcc
gatgatgatatttacgaggagaaactgaagaaagaaacagttgcatttttcatggtcgca
acctacggggatggagagccaactgataatgctgcaaggttttacaagtggttcactgag
ggacaagaacggggtgcatggctgcagaaccttagctatggcgtttttgccctgggtaat
cgccaatatgaacactttaacaagattgggaaggtgatagatgaacaaatgagtgaacaa
ggtgcaaaacgtcttgtgcctgtaggccttggtgatgatgatcagtgcattgaagatgat
tttgctgcctggcgagaacagctgtggccagaattggatcaaattcttagagacgaggat
gatgcaaattctgctgccactccatatacagctgcaattcctgaatatcgtttggttatc
catgataccactatgagtcttgaggataagcatgcaggcatggctaatggtaataccaca
tatgatatccaccatccatgcaaagtcaatgtggctgttcagagagagcttcacacaccc
gagtctgatcgctcatgtatacacttggagtttgatatatctggcactgggatttcctat
gaaacaggagatcatgtgggtgtttatgctgaaaattctgaagatactgttgaggaagct
gcgagattgctggggcaatcattagacttgatattctctatccataccgacaaggaggat
ggtacagctggaggaggctcgctacccccaccttttcctggtccctgcactctgcgtgct
gcacttgctcgttatgcagatcttctgaatccaccgcggaaggctactttggttgcattg
gctacccatgcagctgaaccgagtgaagcagaaaagctcaagttcttggcatctccacag
ggcaaggatgagtattctcaatggattgttgcaagtcaaagaagtcttattgaagtaatg
tctgagttcccatcggcgaagcctccccttggtgtattttttgcagcagttgcccctcgt
ttacagcctcgctactattcaatctcatcatctcctcgatttgcacccgctagagtccat
gtaacctctgcgctagtctatggtccaactcccactggccgaattcataaaggagtgtgt
tcgacttggatgaagaatgcagtacctttggagaaaagtcacaattgcagctctgctccc
attttcattaggccatctaatttcaaattaccagccgacccttcaattccaattgtcatg
gtggggcctgggactggtttggcaccattcaggggattcctgcaggaaagagcagcattg
aaggaagatggcgctcaacttggtcctgctttattgtttttcggttgtaggaatcgtaga
atggactttatttatgaggaggagcttcagagttttgtggatcaaggtgtaatatcagag
ctgattatcgcattttcaagggaagggccacagaaagagtatgttcaacataaaatgatg
gaaaaggcctcccatgtttggagtttaatctcccaggagggatatctatatgtatgtggg
gatgctaaagggatggccagagacgtacatcgtacactccataccatagtccaggagcag
gaaaatgccgactcatccaaagcagaggctgttgtaaagaaactccaaatggatggaaga
tatctcagggatgtgtggtaa

DBGET integrated database retrieval system