KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1115cHelp
Entry
Spy49_1115c       CDS       T00780                                 

Gene name
nagB
Definition
(GenBank) Glucosamine-6-phosphate deaminase
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00520  Amino sugar and nucleotide sugar metabolism
soz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spy49_1115c (nagB)
Enzymes [BR:soz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     Spy49_1115c (nagB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso Sugar-bind TOPRIM_C
Motif
Other DBs
NCBI-ProteinID: ACI61407
UniProt: B5XM45
Position
complement(1112080..1112784)
Genome map
AA seq 234 aa AA seqDB search
MKIIRVQDQIEGGKIAFTLLKDSLAKGAKTLGLATGSSPISFYQEMVKSPLDFSDLTSIN
LDEYVGLSVESDQSYDYFMRQNLFNGKPFKKNYLPNGLATDVEAEAKRYDQIIAEHPIDF
QVLGIGRNGHIGFNEPGTSFEEETHVVDLQESTIEANSRFFTSIEDVPKQAISMGIASIM
KSKMIVLLAFGQEKADAIKGMVFGPITEDLPASILQKHDHVIVIVDEAAASQLD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattcgggtccaagatcagattgaaggtgggaaaatcgcttttaccttattg
aaagatagcttagctaagggagctaagacgttaggattagcaacaggaagttcaccaatt
agtttttaccaagaaatggtcaaaagtcctttggatttttcggacttaacaagtattaac
ttggatgaatatgtcggtctttcagtagagagcgatcagagttatgattattttatgcgt
caaaacctttttaatgggaagccttttaaaaagaattacttgcccaatggtttagcaacc
gatgtcgaagcagaagctaaacgatatgaccaaatcattgcagagcatccgattgatttt
caagtgcttgggattgggcgtaatgggcacattggttttaacgaacctgggacctctttt
gaagaagaaacgcatgtggtggatcttcaagaatcaaccattgaagccaatagtcgtttc
tttacaagtattgaggatgtgccaaaacaagctatctctatgggaattgcctccatcatg
aagtccaaaatgattgttcttcttgcctttggacaagaaaaagctgatgcgatcaaggga
atggtttttggaccaatcacagaagacctcccagcaagtattctccaaaaacatgatcat
gttatcgtcattgtggatgaagctgctgcgtcacaattagactaa

DBGET integrated database retrieval system