KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1116Help
Entry
Spy49_1116        CDS       T00780                                 

Gene name
queA
Definition
(GenBank) S-adenosylmethionine:tRNA ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
KEGG Orthology (KO) [BR:soz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:soz03016]
    Spy49_1116 (queA)
Enzymes [BR:soz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     Spy49_1116 (queA)
Transfer RNA biogenesis [BR:soz03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Spy49_1116 (queA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth
Motif
Other DBs
NCBI-ProteinID: ACI61408
UniProt: B5XM46
Position
1112986..1114014
Genome map
AA seq 342 aa AA seqDB search
MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQLNPGDALVMNN
TRVLPARLYGEKTDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNFGDGHLKATII
DELEHGGRIVEFSYDGIFLEVLESLGEMPLPPYIHEKLEDAERYQTVYAKENGSAAAPTA
GLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHDMHSEFYSLSEEAAQTLR
DVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIKPGYQFKVVDAFSTNFHL
PKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGDAMFVN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaacgattttgattttgagttaccagaagaattgattgcccaaaccccactc
gaaaaaagagacagttcaaaactattgattattgatcaccgtcaaaaaactatggttgat
agccattttgaccatatcattgatcaattaaatccaggggatgccctcgtcatgaataac
acccgtgtcttgcctgccagactttatggagaaaaaaccgatactcatggtcatgtggaa
ttgcttttgcttaaaaatacacaaggagatcaatgggaagttttagccaagccagccaaa
cggctcaaggttggtagccaagtcaattttggagatgggcatctcaaagccaccattatc
gacgaattagaacatggtggacgaattgttgaattcagctatgatgggattttcttagaa
gttttagagagcctcggcgaaatgccattgcctccttatattcacgaaaaattagaggat
gctgagcgataccaaaccgtttatgctaaagaaaatggctctgcggccgccccaactgct
ggtctccacttcacaacagacttgctcaaaaaaatcgaagccaaaggggtacatttggtt
tatttgaccctacatgtagggcttgggacttttagacctgtttccgtggataacctcgat
gagcatgatatgcattcggaattttattccctctcagaagaagcagcgcaaaccctaaga
gacgtaaaacaagctggcggtcgtgttgtcgctgtaggaaccacctctattcgtacgttg
gaaaccatcggaagtaagttccaaggggacattcaagctgattcaggttggaccaatatt
tttattaaaccaggctaccaattcaaggtagttgatgctttttcaactaatttccatctt
ccaaaatcaacccttgtgatgctagtatcagcctttgcagggcgtgactttgtccttgaa
gcttacagacacgcggttgacgaaaaatatcgtttctttagctttggcgatgccatgttt
gtcaactaa

DBGET integrated database retrieval system