KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1126cHelp
Entry
Spy49_1126c       CDS       T00780                                 

Gene name
comE
Definition
(GenBank) Putative competence protein
  KO
K02237  competence protein ComEA
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Module
soz_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:soz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:soz02044]
    Spy49_1126c (comE)
Secretion system [BR:soz02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   Spy49_1126c (comE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_3 HHH SLBB HHH_5 HHH_2 HHH_6 Cdd1 DNA_pol_lambd_f IncA PsbU
Motif
Other DBs
NCBI-ProteinID: ACI61416
UniProt: A0A0H3C182
Position
complement(1120600..1121262)
Genome map
AA seq 220 aa AA seqDB search
MLDELLIKGKSFLRERYFLPYLISLLLGLFLILSFSFLFWGNRQSKAAVPALREISPVKQ
QVSEEKKEIQEDNSILVDLKGAVQKEGVYKLTASSRVRDVIELAGGLTSEADKHAINFAE
KLTDEQVVYVPKQGEEISVLPRSLVSGKKETANKDQSKVHINKASLEELQHIPGIGAKRA
QDIIDMRDKLGGFKALEDLRQVSGIGEKTLEKLKDDIFLD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgaattattaattaaaggaaaatcgtttttgagagagcggtattttctgcca
tacctaattagtcttttattaggactttttctaatactaagcttcagttttttgttctgg
ggaaataggcagagcaaggcagccgttcctgctttgagagaaatatcgcctgtgaaacag
caggttagtgaagaaaaaaaggaaattcaagaagataacagtattttagtggatttaaaa
ggcgccgtacaaaaagagggagtttataagctaactgctagcagtcgtgtgcgagatgtc
attgaactagctggaggcctaacttcagaagctgataaacatgctattaattttgcagaa
aaactaactgatgagcaagttgtttatgtacctaaacaaggagaagagatttctgtgcta
ccaaggtcattagtttctggtaaaaaagaaactgccaacaaggatcagtcaaaggttcat
attaataaggccagcttagaagaactacaacatatcccaggtattggtgctaaaagagct
caggatattattgatatgagagataagttaggtggttttaaagcgttagaagatctccgt
caggtttcggggattggcgaaaaaacgctcgagaaattaaaagatgacattttcttggac
taa

DBGET integrated database retrieval system