KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1128Help
Entry
Spy49_1128        CDS       T00780                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Cons_hypoth95 UPF0020 Methyltransf_25 Methyltransf_31 Methyltransf_15 Methyltransf_16 Met_10 Methyltransf_10
Motif
Other DBs
NCBI-ProteinID: ACI61418
UniProt: A0A0H3BYZ3
Position
1122242..1123096
Genome map
AA seq 284 aa AA seqDB search
MKADFSKVKITLQTFTSSLFYVKITGMIKAILKEGERIDQLFSSDVGIIQNKDVFSYSID
SVLLSRFPKMPSKGLIVDLCSGNGAVGLFASTRTKAAIVEVELQERLADMGQRSIQLNQL
EDQVTMICDDLKNLLNHVPRSGVDLMLCNPPYFKSHESSKKNVSEHYLLARHEVTTTLEE
ICQVARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAI
KDGSIEGMTILPPLVVHKENGEYTDHIFEIYFGAASKGKPNHDH
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgacttttcgaaagtcaaaatcactcttcaaacattcacctcaagcctattt
tatgttaaaataacaggtatgataaaagcaatcttaaaagaaggcgaacgtattgatcaa
ctcttttcaagtgatgttggcattattcaaaacaaggatgtctttagttactctattgat
agcgtcctcttatcccgcttccccaagatgccttccaaagggttaattgtggatttgtgc
tcaggaaatggggcggttggcttatttgctagcactagaaccaaggcagccatcgttgaa
gtagaattacaagaacggcttgctgatatgggacaacgctctatccagctcaatcaactg
gaagaccaagtaaccatgatttgtgatgatttaaaaaacctcctaaaccatgtgccacgt
tcaggagttgatttgatgctctgcaatcccccttactttaaaagtcacgaaagttctaag
aagaacgtctctgaacattatttactggctcgtcatgaagtgaccactactttagaagag
atttgtcaggtagcccgtcatgcccttaaatcaaatggtcgtctggcaatggttcatcga
ccagatcgattcttggaaattatagatagccttagagctaatggtcttgcccctaaaagg
gtacaatttgtctatcctaaattaggtaaatcagctaatatgttacttattgaagcaatc
aaagacggttctattgaagggatgactattttacctcctttagttgtccacaaggaaaac
ggagaatacactgatcatatttttgagatttattttggtgctgcttccaaaggaaaacct
aatcatgaccactaa

DBGET integrated database retrieval system