KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1138cHelp
Entry
Spy49_1138c       CDS       T00780                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:soz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spy49_1138c (recR)
DNA repair and recombination proteins [BR:soz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Spy49_1138c (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Spy49_1138c (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: ACI61426
UniProt: B5XM64
Position
complement(1132738..1133334)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMDGKVSEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttatccaacacccattgcaaagttaattgacagttactctaaacttccaggaatt
ggtatcaagacggcgacgagattagccttttatactattggaatgtcaaatgaagatgtc
aatgattttgctaaaaacttattagcagctaaaagagaactgacctattgttcgatttgt
ggaaaccttaccgatgacgatccttgtcacatttgcacagatacgagtcgtgatcagacg
accattctggtagtagaagatgctaaagatgtttctgccatggaaaaaatccaagagtat
catggctattatcatgtgcttcacggcttgatttcgcctatgaatggtgtggggccagat
gacatcaaccttaaaagtttaattacccgtctaatggatggtaaggtgagcgaagttatc
gtagctaccaatgccacagcagatggggaagcaacgtccatgtatatttcacgtgtcttg
aaaccagccggaattaaggtaactcgtttggcaagaggtctcgcagtaggttcagatatt
gagtatgctgatgaagtaacattattgagagctattgagaatcgtactgaactttaa

DBGET integrated database retrieval system