KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1140cHelp
Entry
Spy49_1140c       CDS       T00780                                 

Gene name
fdhC
Definition
(GenBank) Formate/nitrite transporter family member
  KO
K21993  formate transporter
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
KEGG Orthology (KO) [BR:soz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:soz02000]
    Spy49_1140c (fdhC)
Transporters [BR:soz02000]
 Other Transporters
  Pores ion channels [TC:1]
   Spy49_1140c (fdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans SurA_N_3
Motif
Other DBs
NCBI-ProteinID: ACI61428
UniProt: A0A0H3BZH0
Position
complement(1134132..1134947)
Genome map
AA seq 271 aa AA seqDB search
MCVCEYSNKRRYHENPEQILEATIHIGEHKVTKTFLAKSILGFIGGAMISLGYLLYVRIA
ASGLETFGAFSSIVGACAFPIGLIIILMAGGELITGNMMAVSAALLAKKIKFSELAKNWL
IITLFNVIGAVFVAFVFGHFLGLTSAGIFKEEVIEVAHAKIAASPLQALVSGIGCNWFVG
LALWLCYGANDAAGKFLGTWFPVMTFVALGFQHSVANAFVIPAAIFEGGATWLDFATNFI
FVYSGNIIGGAIFVSFLYFKVYYHPQKSKTQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtttgtgaatacagtaacaaaaggagatatcatgaaaacccagaacagatttta
gaagcaactattcatattggggaacataaggttaccaaaacttttttggctaaatctatc
ttaggctttattggtggagcgatgattagccttggttatttactctacgtgagaattgcc
gccagtggtttagaaacttttggtgctttttccagtatcgtaggagcttgtgcttttccg
attggtctaattattattttaatggcgggtggagaattaattacagggaacatgatggct
gtttctgcagctttgttggccaaaaaaattaagtttagcgagcttgccaagaattggctt
atcattaccttgtttaatgtgattggagctgtttttgtagcttttgtgtttggtcatttt
ctaggcttgacatcagctggtatttttaaagaagaagtgattgaggtggcccatgctaaa
atagcagcgagccctttgcaggcactagtatcaggaattggttgtaactggtttgttggt
ttggccttgtggctatgctatggggcaaatgatgctgctggtaaattccttggtacttgg
tttcctgtcatgacctttgtagcccttggttttcagcatagtgtagcaaacgcttttgtc
attcctgctgctatttttgaaggaggagcaacatggttggattttgccactaattttatt
tttgtctatagtggtaatattatcggtggagccatttttgttagttttttatattttaaa
gtttactatcatccgcaaaagagtaaaactcaatga

DBGET integrated database retrieval system