KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1141cHelp
Entry
Spy49_1141c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
  KO
K16788  niacin transporter
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Transporters [BR:soz02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Spy49_1141c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI61429
UniProt: A0A0H3C0P4
Position
complement(1135034..1135576)
Genome map
AA seq 180 aa AA seqDB search
MTKKPTQLIAYTSILVAFAILIPIIMPLKLIIGPASFTLASHVPLFLAIFMSIPVAILVA
LGTTLGFLLAGLPLIIVLRALSHLLFAILAAWWLSRKPQLMTSAVKCFSFAFFINVIHGL
AEFLVVYILTATTATSMSYFWSMLGLIGLGSLIHGILDFYLALVLWRFLAKNLKLPTINA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaccaacacaactaatagcttatacctctattttggtcgcatttgcgatt
ttgattccgataatcatgcctcttaagcttattattggaccagcttcctttactctggcg
agccatgttcctttgtttttggctatttttatgtcgattccagtagcaattttggtcgct
cttggtaccacattaggttttttattagctggactacctttaattattgttttaagagca
ctctctcatttattgtttgctattttggcagcgtggtggttaagtagaaaaccacaattg
atgacatcggcagtaaaatgttttagttttgcgtttttcattaatgtcattcatggcttg
gctgaatttttagttgtctatattttaacagcaaccacagcaacttctatgtcttatttt
tggtctatgctaggcttgattggcttaggttcgcttattcatggcatattggatttctat
cttgctttagttctatggcgttttttagcaaaaaacttaaaacttcccaccataaatgcc
taa

DBGET integrated database retrieval system