KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1148cHelp
Entry
Spy49_1148c       CDS       T00780                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2140
Motif
Other DBs
NCBI-ProteinID: ACI61436
UniProt: A0A0H3C195
Position
complement(1141106..1141693)
Genome map
AA seq 195 aa AA seqDB search
MKKKSNLNWWKWSFLCLLAFNTAFLMVIASRLIQVREPESELIAKKPVKNIKIGTFVTTR
DQLNETVASYLKDYQTKKMSYKFYATSSSILFEGTYQLLGYEVPLYIYSQPHRLENGAVQ
LQVISFSVGTLPLPKKDVLQYLKSSYKLPSFVKVMPNQSAIVVNLQDIQNDAKVYLKAKK
IDLFNDEISFNIYKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaatcaaaccttaattggtggaagtggagcttcttatgtctgcttgctttt
aataccgcctttttgatggttattgcaagtcgtctcattcaagtaagagaacctgagtca
gaactgattgctaaaaaaccagttaaaaatatcaaaattggtacatttgtcacaaccaga
gaccagcttaacgaaactgtagcaagttatcttaaagattatcagactaaaaaaatgtct
tataaattttatgcgacatcttcttctattttgtttgaaggaacttatcaattattaggg
tatgaagtccctttatatatctattctcaacctcatcgtctagaaaatggagctgtccaa
ctacaggtgatctctttttcagtgggaactctgccactcccaaaaaaagatgttttgcag
tatttgaaatcaagctacaaattgccaagctttgttaaagtgatgccaaatcaatcagct
atcgttgttaatttacaagatatccaaaatgatgctaaggtttatttaaaagccaagaaa
attgatttatttaatgatgaaatcagttttaacatctataagaaataa

DBGET integrated database retrieval system