KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1157cHelp
Entry
Spy49_1157c       CDS       T00780                                 

Gene name
xseA
Definition
(GenBank) Probable exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:soz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Spy49_1157c (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:soz03400]
    Spy49_1157c (xseA)
Enzymes [BR:soz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Spy49_1157c (xseA)
DNA repair and recombination proteins [BR:soz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     Spy49_1157c (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon HTS
Motif
Other DBs
NCBI-ProteinID: ACI61445
UniProt: B5XM83
Position
complement(1148725..1150065)
Genome map
AA seq 446 aa AA seqDB search
MADYLTVTHLTKYLKLKFDRDPYLERVYLTGQVSNFRKRPTHQYFSLKDESAVIQATMWA
GVYKKLGFDLEEGMKINVIGRVQLYEPSGSYSIVIEKAEPDGIGALALQFEQLKKKLTAE
GYFEQKHKQPLPQFVSKIGVITSPSGAVIRDIITTVSRRFPGVEILLFPTKVQGDGAAQE
VVANIRRANQREDLDLLIVGRGGGSIEDLWAFNEEIVVQAIFESQLPVISSVGHETDTTL
ADFVADRRAATPTAAAELATPITKTDLMSWIVERQNRSYQACLRRIKQRQEWVDKLSQSV
IFRQPERLYDAYLQKIDRLSMTLMNTMKDRLSSAKENKVQLDHALANSQLQTKIERYQDR
VATAKRLLMANMASQYDSQLARFEKAQDALLSLDTSRIIARGYAMIEKNQALVASVSQIT
KGDQLTIKMRDGQLDVEVKDVKNENI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcagattatttaaccgtcactcatttgacgaaatatttaaaattaaaatttgaccgt
gacccttatttggaacgggtttatctgactggtcaagtgtccaattttcgaaaacgacca
actcatcaatatttttccttaaaggatgaaagtgctgtgattcaagccaccatgtgggca
ggagtctataaaaaactaggattcgacctagaagaaggcatgaaaattaatgtaattggg
cgagttcaactttatgaacctagtggctcttactctatcgtgattgaaaaggcagagcca
gatggtataggtgccttggctttgcagtttgaacaattaaagaaaaaattaacggcagaa
ggttattttgagcaaaaacacaagcagcctttgccacagtttgtatcaaaaattggggtc
attacaagtcctagtggtgctgtgattcgagatattatcacaaccgtttcacggcgtttt
ccaggggttgagattttattattcccaactaaagtacaaggtgatggagccgcccaagaa
gtagtggctaatattcgaagagccaatcaaagagaggatttggacttgctcattgtcggc
cgtggaggtggctcgatagaagacctttgggccttcaacgaggaaatagtggttcaggct
atctttgaatcgcaacttccagtgatttcgagtgtgggtcatgaaacagacacgacttta
gcggattttgtggcagatcgcagagcagccacaccaacagcagcagcagagttagcaacg
cctattacaaaaacagatcttatgtcttggatagtagagcggcaaaatcgttcctatcag
gcctgcttgaggcggattaagcaacggcaagagtgggtggataaactctcgcaatctgtt
atttttaggcaaccagaacgattatatgatgcctacctgcaaaaaattgatcgccttagc
atgaccctgatgaatacgatgaaagatcgtctgagttccgccaaagaaaacaaggttcag
ttggaccatgccttggccaatagtcaattacagacaaaaatcgagcgataccaagaccgt
gttgctaccgctaagcgtttactgatggctaatatggctagtcaatatgatagtcagctg
gctcgctttgaaaaagcacaggatgctttgctatcactggataccagccgaattatcgcc
cgtggttatgcaatgattgaaaaaaatcaagcactggtagcctctgtaagtcagataaca
aagggtgatcagttaaccattaagatgcgtgatggacaattagatgtagaggtaaaagat
gtcaaaaacgaaaacatttga

DBGET integrated database retrieval system