KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1167cHelp
Entry
Spy49_1167c       CDS       T00780                                 

Gene name
ileS
Definition
(GenBank) Isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00970  Aminoacyl-tRNA biosynthesis
Module
soz_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:soz00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Spy49_1167c (ileS)
Enzymes [BR:soz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Spy49_1167c (ileS)
Amino acid related enzymes [BR:soz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Spy49_1167c (ileS)
Transfer RNA biogenesis [BR:soz03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Spy49_1167c (ileS)
 Prokaryotic Type
   Other AARSs
    Spy49_1167c (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1_2 DUF4729
Motif
Other DBs
NCBI-ProteinID: ACI61455
UniProt: A0A0H3BXY9
Position
complement(1160268..1163024)
Genome map
AA seq 918 aa AA seqDB search
MRAGLPNKEPQWQAAWEQAELYKKRQELNAGKPAFHLHDGPPYANGNIHVGHALNKISKD
IIVRSKSMSGFQAPYVPGWDTHGLPIEQVLAKQGIKRKEMDLAEYLEMCRQYALSQVDKQ
RNDFKRLGVSADWENPYVTLDPQFEADQIRVFGAMAEKGYIYRGAKPVYWSWSSESALAE
AEIEYHDIDSTSLYYANKVKDGKGILDTNTYIVVWTTTPFTVTASRGLTVGPDMDYLVVK
PAGSDRQYVVAEGLLNSLAGKFGWESFETLASHKGADLEYIVTEHPWDTDVEELVILGDH
VTLESGTGIVHTAPGFGEDDYNVGTKYKLEVAVTVDERGLMMENAGPDFHGQFYNKVTPI
VIDKLGDLLLAQEVINHSYPFDWRTKKPIIWRAVPQWFASVSDFRQDILDEIEKTTFHPS
WGETRLYNMIRDRGDWVISRQRAWGVPLPIFYAEDGTAIMTKEVTDHVADLFQENGSIIW
WQKEAKDLLPEGFTHPGSPNGEFTKETDIMDVWFDSGSSWNGVMNARENLSYPADLYLEG
SDQYRGWFNSSLITSVAVNGHAPYKAILSQGFVLDGKGEKMSKSKGNIISPNDVAKQYGA
DILRLWVASVDTDNDVRVSMEILGQVSETYRKIRNTLRFLIANTSDFNPATDTVAYADLG
AVDKYMTIVFNQLVATITDAYERYDFMAIYKAVVNFVTVDLSAFYLDFAKDVVYIEAANS
LERRRMQTVFYDILVKITKLLTPILPHTTEEIWSYLEHESEAFVQLTEMPVAETFSAQED
ILEAWSAFMTLRTQAQKALEEARNAKVIGKSLEAHLTIYASEEVKTLLTALDSDIALLLI
VSQLTIADLADAPADAVAFEGIAFMVEHAIGEVCERSRRIDPTTRMRSYNAFVCDHSAKI
IEENFPEAVAEGFEESGK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcaggtcttcctaataaagagccacaatggcaagcagcttgggaacaagcagag
ctttacaaaaaacgtcaagaattgaatgcaggtaagcctgcctttcatcttcatgatgga
cctccttacgctaacggcaatattcacgttgggcatgcccttaataaaatttcaaaagat
atcattgtgcgttctaagtccatgtctggctttcaagcgccttatgtaccaggttgggac
acacacggccttccaatcgaacaagtcttggctaagcaaggaatcaaacgtaaggagatg
gatttagcagaataccttgagatgtgtcgtcaatacgctttaagtcaggttgataaacag
cgaaatgatttcaaacggttaggtgtttcggcagactgggaaaatccttatgtcactttg
gacccacagtttgaagctgatcaaattcgtgtttttggagcgatggctgaaaaaggttac
atctatcgtggtgctaaacctgtttattggtcatggtcttcagaatcggccttggcagaa
gctgaaattgaataccatgacatcgattcaacctctttatactacgccaataaagttaaa
gatggtaaaggcatccttgatactaatacgtatatcgttgtttggaccacaacaccattt
accgttacagcatcacgcggtttgactgttggtcctgatatggattatcttgtggtgaaa
cctgctggttcagaccgtcaatatgttgtggcagaaggtcttttgaatagccttgctgga
aaatttggctgggaatcttttgaaactttagccagccataaaggagctgatttagagtac
attgtgacagaacacccatgggatactgacgtagaagaattggttatccttggtgaccat
gttacccttgagtcagggacagggattgtccacacggcgccaggttttggtgaagatgac
tacaatgttgggacaaaatataaactggaagttgctgtgactgttgatgaacgtggccta
atgatggaaaatgcaggtccagatttccacggacaattttataacaaggtaacgccgatt
gtcattgataaacttggtgatcttttattggcacaagaagtgatcaatcactcttaccca
tttgactggcggacgaaaaaaccaatcatctggcgtgctgtaccgcaatggtttgcttct
gtttctgatttccgtcaagatattttggatgaaattgaaaaaacaaccttccatccatca
tggggtgaaacacgcctttacaatatgattcgtgatcgtggcgactgggttatttctcgt
caacgtgcttggggagttccgcttcctatcttctatgccgaagatggcacagctattatg
actaaagaagtgacagatcatgtggctgatttgttccaagaaaatggatcaatcatttgg
tggcaaaaagaagctaaagacctattaccagagggcttcactcatccagggtcaccaaat
ggcgagtttacaaaagaaactgatatcatggacgtttggtttgactctggttcttcttgg
aatggagtcatgaatgctagagaaaatctttcctatccagcggatctctacttagaaggc
tctgaccagtatcgtggttggttcaattcatccttaattacatctgtggctgttaatggg
catgctccatataaggctattttatcgcaaggctttgttcttgatggtaagggcgaaaaa
atgtctaaatcaaaaggcaatatcatttctccaaatgatgtggctaaacaatatggtgca
gatattctccgtctctgggtagcttctgtggataccgataatgatgttcgtgtttctatg
gagattcttggtcaagtctctgaaacttaccgtaaaatccgtaacacccttcgcttcttg
attgctaatacatctgatttcaaccctgctacggatacagtagcttatgcagacttagga
gctgttgataagtacatgacaattgtctttaatcagttggtagcaacgattactgacgct
tatgagcgttatgactttatggctatttacaaagcagtggtgaactttgttacggttgat
ttatcagccttctatcttgattttgctaaagacgttgtctatattgaagctgccaatagc
ttagaacgtcgtcgcatgcagacagtcttctatgatatcttggttaagattaccaagtta
ttgacgccaatcttgcctcacactactgaagaaatctggtcttatctagagcatgagtca
gaagcatttgttcaattgacagaaatgcctgtggcagaaaccttctcagctcaagaggat
attttagaagcttggtcagctttcatgactttgcgtacccaagctcaaaaagctttggaa
gaagcgcgaaatgccaaggttattgggaaatcattggaagctcatttgactatctacgct
agcgaagaagtgaaaaccttattgactgctttagacagcgatattgctttgcttttgatc
gtgtctcaattaaccattgctgacttggcagatgcgcctgcggatgcagtggcatttgaa
ggtattgcctttatggtagaacatgccataggtgaagtttgtgagcgttcacgccgcatc
gacccaactactcgcatgcgttcttacaatgcatttgtctgtgatcacagcgctaaaatc
attgaagaaaatttcccagaagctgtggctgaagggtttgaagagagtggcaaataa

DBGET integrated database retrieval system