KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1180cHelp
Entry
Spy49_1180c       CDS       T00780                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese FtsH_ext
Motif
Other DBs
NCBI-ProteinID: ACI61468
UniProt: A0A0H3BZ28
Position
complement(1175762..1176151)
Genome map
AA seq 129 aa AA seqDB search
MSPITLILWLLLVGIVGYYTWNYFSFRKMAKQVDNETFKDVMRQGQLIDLREPAAFRTKH
ILGARNFPAQQFDAAIKGLRKDKPVLIYENMRPQYRVPAVKKLKKAGFEDVYVLKDGIDY
WDGKVKQTT
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaatcacacttatcttatggttacttcttgtcggcattgttggttattataca
tggaactatttctcttttcgaaaaatggcaaagcaggttgataacgagacttttaaagac
gtgatgcgtcaaggtcaattgattgatttacgagagccagcggcttttagaactaagcat
attttaggagctcgaaattttccagcgcaacaatttgatgctgctattaagggactacgc
aaggacaaacctgttcttatttacgaaaatatgcgtccccagtaccgtgtgcctgcggtc
aaaaaacttaaaaaagctggctttgaagacgtttatgtcttaaaagacggtattgattat
tgggatggcaaagttaaacaaacaacctag

DBGET integrated database retrieval system