KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1192cHelp
Entry
Spy49_1192c       CDS       T00780                                 

Gene name
arcC
Definition
(GenBank) Carbamate kinase
  KO
K00926  carbamate kinase [EC:2.7.2.2]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00220  Arginine biosynthesis
soz00230  Purine metabolism
soz00910  Nitrogen metabolism
soz01100  Metabolic pathways
soz01120  Microbial metabolism in diverse environments
soz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:soz00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Spy49_1192c (arcC)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Spy49_1192c (arcC)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Spy49_1192c (arcC)
Enzymes [BR:soz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     Spy49_1192c (arcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ACI61480
UniProt: A0A0H3BY05
Position
complement(1185959..1186909)
Genome map
AA seq 316 aa AA seqDB search
MTKQKIVVALGGNAILSTDASAKAQQEALISTSKSLVKLIKEGHEVIVTHGNGPQVGNLL
LQQAAADSEKNPAMPLDTCVAMTEGSIGFWLVNALDNELQAQGIQKEVAAVVTQVIVDAK
DPAFENPTKPIGPFLTEEDAKKQMAESGASFKEDAGRGWRKVVPSPKPVGIKEANVIRSL
VDSGVVVVSAGGGGVPVVEDATSKSLTGVEAVIDKDFASQTLSELVDADLFIVLTGVDNV
YINFNKPDQAKLEEVTVSQMKEYITQDQFAPGSMLPKVEAAIAFVENKPNAKAIITSLEN
IDNVLSANAGTQIIAG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacaaaaaatcgtagtcgcacttggaggaaatgctattctttcaacagatgcg
tcagcaaaagcacaacaagaagccttgatttccacatcaaaatcattggttaaattaatt
aaagaaggtcatgaagtcatcgtgacccacggcaatggcccacaagttggtaatctctta
ttacaacaagcagcggcagattctgaaaagaatccggctatgcctttggatacttgtgtt
gccatgacagaaggtagcattggtttttggttagtcaatgcccttgataatgaattgcaa
gcccaaggtattcaaaaagaagtggcagctgttgtcactcaagtgatcgtggatgccaaa
gacccagcttttgaaaacccaacaaaaccaattggtccatttcttaccgaagaagatgcc
aaaaaacaaatggcggagtctggtgcaagtttcaaagaagatgcaggtcgtggctggcgt
aaggttgtgccatcaccaaaaccagttggtattaaagaagccaatgtcatcagaagtctc
gttgattctggcgttgttgtggttagtgctggtggtggcggtgtgcctgttgtggaagat
gcaactagcaagtccctgactggtgtggaagctgttattgacaaggactttgctagccaa
accctttcagaattggtggatgcagacctctttatcgttttgacaggagttgacaatgtt
tacatcaacttcaacaaacctgaccaagccaaattggaagaagtgactgtctctcaaatg
aaagaatacatcacacaagaccaatttgcaccaggtagtatgttaccaaaagtggaagct
gccattgcttttgttgaaaacaaaccaaatgctaaagccattatcacatcgctagaaaat
attgacaatgtactatcagcaaacgctggaacacaaattatcgcaggataa

DBGET integrated database retrieval system