KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1196cHelp
Entry
Spy49_1196c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 Acetyltransf_4 GNAT_acetyltr_2 Acetyltransf_CG Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: ACI61484
UniProt: A0A0H3C0S0
Position
complement(1190979..1191419)
Genome map
AA seq 146 aa AA seqDB search
MTDKFDANDETRTVYAVVYDNDQPVSTGQFLAETKIEARLTRIVTLADYRGQGYGAKVIE
ALETYARQEGFRQLTIHSELTAQTFYESLGYQAYGSKYLEDGEYCQSLAKTILKWEKNMD
IAMLVAIVGGLLGCYLYLTKNNEPKD
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaatttgatgccaatgacgaaacaagaacggtttatgcagtcgtttatgac
aatgaccagcccgtttcaacaggacaatttttagctgaaacgaaaatagaagcacgattg
acacgcattgtaaccttagcagactatcgtgggcagggttatggtgctaaagtcattgaa
gcgctcgaaacttatgcccgacaggaaggctttcgccaactaaccattcatagcgaattg
acagcccaaaccttttatgaaagcctaggttatcaggcctatggttccaagtatttagaa
gatggtgagtattgtcaatcccttgcaaaaaccattcttaaatgggagaagaatatggac
atagcaatgctagttgcgattgttggtggtctattaggctgctatctctatctcacaaaa
aataatgaacccaaagattaa

DBGET integrated database retrieval system