KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1200cHelp
Entry
Spy49_1200c       CDS       T00780                                 

Definition
(GenBank) Conserved protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B3_4
Motif
Other DBs
NCBI-ProteinID: ACI61488
UniProt: A0A0H3BY08
Position
complement(1194490..1195206)
Genome map
AA seq 238 aa AA seqDB search
MVEFVADQSFWELFPDAKLGVVLLKDVQNQAESPEDVKQLLAESHELAKAYLTADNFSDN
QVVQVYRKAYQHFKTKKGARSSIEALLKRVSNGQSIPSINPLVDIYNAASLRFGLPAGAE
DSDSFIGDLRLTITDGGDDFYLIGDADNNPTLPNELCYKDDIGAVCRCLNWRDGERTMVT
EHTKNAFLIIEALDQEGQNRLQEALKFIEGSAKMYLHAITSVHVLDKDNPHVPLFTEN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatttgtagcagatcaaagtttttgggaactttttccagatgccaaactaggt
gtcgtcttattaaaggatgttcagaatcaagcagagtcaccagaagatgtcaaacagctc
ttagcagaaagccatgagttagcaaaagcttatttaacagcagacaattttagtgataat
caggtggttcaagtctaccgcaaggcctatcaacactttaaaaccaaaaaaggagctcgc
tctagcattgaagcccttctcaagcgggtgtcaaatggtcaaagcattccgtctattaac
ccactagtggatatttataatgcggctagtctacgttttggtttacctgctggagccgaa
gatagtgacagttttatcggagatttgcgtctgacgataacagatggtggtgacgacttt
tacttgattggggatgctgacaacaacccaaccttgccaaatgaactctgttataaagat
gatattggagcggtttgtcgttgccttaactggcgagatggcgaacgcaccatggtgaca
gaacacaccaaaaatgcatttctgattatcgaagctcttgatcaagaaggtcaaaataga
ttgcaagaagctctgaaattcattgaaggcagcgcaaaaatgtaccttcatgcaatcact
tctgtgcatgtgttggataaagacaatccacacgtgccgctttttacagaaaactag

DBGET integrated database retrieval system