KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1203cHelp
Entry
Spy49_1203c       CDS       T00780                                 

Gene name
yesN
Definition
(GenBank) Putative two-component response regulator
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_18 HTH_AraC HTH_26 HTH_3
Motif
Other DBs
NCBI-ProteinID: ACI61491
UniProt: A0A0H3C0S2
Position
complement(1198102..1198842)
Genome map
AA seq 246 aa AA seqDB search
MYSLLIVEDEYLVRQGIRSLVDFSQFKIDRVNEAENGQLAWDLFQKGPYDIILTDINMPK
LNGIQLAELIKQESPQTHLVFLTGYDDFNYALSALKLGADDYLLKPFSKADVEDMLGKLQ
QKLELSKKTETIQELVEQPQKEVSAIAMAIHERLADSDLTLKSLAQQLGFSPNYLSVLIK
KELGMPFQDYLVQERLKKAKLLLLTSNLKIYEIAEQVGFEDMNYFSQRFKQLVGVTPSQY
KKGGQA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgtactcattgttaattgtagaagacgaataccttgtgcgccagggtattcgttctttg
gttgattttagccagttcaagattgatcgggtcaacgaagcagaaaatggccagttggct
tgggacttgtttcagaaagggccttatgatattattttgacggatatcaatatgcccaaa
ttaaatgggattcaactagcagaactcattaaacaggaatccccccaaactcatctggta
tttttgacgggctacgatgattttaactatgccttatctgctttgaaattaggggcagat
gattacttgctcaaacccttttccaaggcagatgtagaagacatgttaggaaagctccag
caaaaattagaactttccaagaaaacagaaaccattcaggaattggttgagcagcctcaa
aaagaagtatcagcaatagcaatggctattcatgagcggttggcagattctgatttgacc
ctaaaaagcttggctcagcagcttggttttagccctaattaccttagcgtcttgattaaa
aaagagttagggatgccctttcaagattatctggtacaagaacggttgaaaaaagccaag
cttctcttgttaaccagtaaccttaaaatctatgaaattgcagaacaggtcggttttgag
gacatgaattatttttctcagcgctttaagcaactggtaggcgttaccccaagtcagtat
aaaaaaggaggccaggcatga

DBGET integrated database retrieval system