KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1206cHelp
Entry
Spy49_1206c       CDS       T00780                                 

Gene name
ccdA
Definition
(GenBank) Cytochrome c-type biogenesis protein
  KO
K06196  cytochrome c-type biogenesis protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
KEGG Orthology (KO) [BR:soz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:soz02000]
    Spy49_1206c (ccdA)
Transporters [BR:soz02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   Spy49_1206c (ccdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD DsbD_2
Motif
Other DBs
NCBI-ProteinID: ACI61494
UniProt: A0A0H3BZ41
Position
complement(1200715..1201404)
Genome map
AA seq 229 aa AA seqDB search
MVSVFGAGLLSFFSPCIFPVLPVYLGILLDADDSKTITIFGKKLYWYGIVKTLAFIFGLS
TIFVILGYGAGFLGNILYAVWFRYLLGAVVIILGIHQMGLITIKSLQFQKSLTFHNNKNR
NGLFNAFILGLTFSFGWTPCVGPVLSSVLALVASGGNGAWQGGVLMIIYTLGLGIPFLLI
SFASGIVLKQFNKLKPHMLLLKKVGGVLIIVMGILLMTGTLNNLAQLFG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggtatcggtttttggggcaggcttgttatcatttttctctccgtgtatctttccggtc
cttcctgtctatttaggcattttactggatgcagatgattcaaagacgattactatattt
ggtaaaaaactctattggtatggcattgtcaaaaccttagcctttatttttggtctatct
actatttttgtgattttaggttacggggctggttttttaggaaatatcctttatgcggta
tggtttcggtacttactgggagccgtggtcattatcttggggattcatcagatgggcctc
attaccattaagagcttacaatttcaaaaatcactgactttccataataacaagaatcgc
aacggtttgttcaatgcatttatccttggtttaacctttagctttggttggacgccttgt
gtgggacctgttttgagttctgttctagctttggtggcttcagggggaaatggtgcctgg
caaggtggcgttttgatgattatttatactcttggattgggcattcctttcctgcttatc
tcttttgcgtcaggcattgttttgaaacagtttaacaagctcaaaccccacatgctttta
ctgaaaaaagtaggaggcgttctgattatagtcatgggaatcttgcttatgacaggaacc
ttaaataacttagcacaactttttggataa

DBGET integrated database retrieval system