KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1208cHelp
Entry
Spy49_1208c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
  KO
K15342  CRISP-associated protein Cas1
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
KEGG Orthology (KO) [BR:soz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:soz03400]
    Spy49_1208c
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:soz02048]
    Spy49_1208c
DNA repair and recombination proteins [BR:soz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     Spy49_1208c
Prokaryotic defense system [BR:soz02048]
 CRISPR-Cas system
  Universal Cas proteins
   Spy49_1208c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cas_Cas1
Motif
Other DBs
NCBI-ProteinID: ACI61496
UniProt: A0A0H3C0S6
Position
complement(1202401..1203426)
Genome map
AA seq 341 aa AA seqDB search
MKKLLNTLYLTQEDFYVTKEGDNIVIKQEGKVLKRFPFRIIDGIVCFSYLGVSSALVKLC
TENQINLSFHTPQGRFCGRYIGSTNGNVLLRREHYRLSDREESLEYAKRFILAKISNSRK
YLLRFKRDHRQQIDTKLFEAVNDELIWALEMVQAADNKDSLRGIEGQAANQYFRIFNDLV
LTDKKTFYFQGRSKRPPLDCVNALLSFGYSLLTFECQSALEAVGLDSYVGFFHTDRPGRA
SLALDLVEEFRSYIVDRFVFSLINKGQLQKKHFEVKENGSILLTENGRAIFIDLWQKRKH
TEVEHPFTKEKVKLMLLPYVQAQLLAKAIRGDLESYPPFMV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttgctaaataccttgtatttgacgcaagaagatttttatgtcactaaagag
ggcgataacattgttatcaagcaagaaggtaaggttctcaaacggtttccgtttcggatt
attgacggtattgtctgtttttcttatttgggtgtgtcgtctgctttggtgaagttatgt
acggagaatcagattaatttatcgtttcatacaccacaagggcgtttttgtggtcgctat
attggttcaaccaatgggaatgtgttgttgcgtagagaacattatcgtttatctgatcgt
gaggaatctttggaatacgcaaagcggtttattttggctaaaatttccaactcaaggaaa
tacttgctacgctttaaacgagatcatcgtcaacagattgataccaagctttttgaggct
gttaatgacgaattgatatgggctttagagatggttcaggcagcagataataaagactct
ttaagagggattgaaggccaagctgctaatcagtattttcgcatatttaatgacctggtg
ttgacggacaaaaaaacgttttacttccaaggtcggagtaaacgaccacccttagattgt
gttaatgccctcttgtcttttggttacagtttactgacctttgaatgtcaatctgccttg
gaagctgtcggattagacagttacgttggtttctttcacacggatcgtcctgggcgtgct
agtttagcgcttgatttagttgaagagttccgctcatatattgtagatcgttttgtcttt
tcattaattaataaaggacaacttcagaaaaaacactttgaggttaaagaaaatggtagt
attttattgacggaaaatggcagagctatttttattgatttgtggcagaagcgtaagcat
actgaggtagaacatccttttacaaaagaaaaagtaaaacttatgttattaccctatgta
caagcgcagcttttagctaaggccatacgaggagatttagaaagctatccaccttttatg
gtttag

DBGET integrated database retrieval system