KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1212cHelp
Entry
Spy49_1212c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
  KO
K19119  CRISPR-associated protein Cas5d
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Prokaryotic defense system [BR:soz02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-C factors
    Spy49_1212c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cas_Cas5d
Motif
Other DBs
NCBI-ProteinID: ACI61500
UniProt: A0A0H3BZM7
Structure
PDB: 

Position
complement(1206847..1207575)
Genome map
AA seq 242 aa AA seqDB search
MYRSRDFYVRVSGQRALFTNPATKGGSERSSYSVPTRQALNGIVDAIYYKPTFTNIVTEI
KVINQIQTELQGVRALLHDYSADLSYVSYLSDVVYLIKFHFVWNEDRKDLNSDRLPAKHE
AIMERSIRKGGRRDVFLGTRECLGLVDDISQEEYETTVSYYNGVNIDLGIMFHSFAYPKD
KKTPLKSYFTKTVMKNGVITFKAQSECDIVNTLSSYAFKAPEEIKSVNDECMEYDAMEKG
EN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
ttgtacagatctagagacttctacgtgagagtaagtggtcagcgagctctttttacaaat
ccagccacaaaagggggatcggaacgctcatcctattcggttccgactagacaggcactg
aatggtatcgttgatgccatctattataagccgacctttactaatatcgtcacagagatt
aaggttattaaccagattcaaaccgaattacagggtgtcagggctctgttacatgattat
agtgcagatttaagttatgtatcctatttgagtgatgttgtttatctgatcaagtttcat
tttgtttggaatgaagatagaaaagatttgaactcagatagacttccagctaaacatgaa
gccattatggagcgttctattcgtaaagggggacgtcgagatgtgtttttgggtacaaga
gaatgtttagggcttgtagatgatatcagccaagaagagtatgagactactgtgtcgtat
tataatggcgtcaatatcgacttgggaatcatgttccattcctttgcctatccgaaggac
aaaaagacaccattaaaatcatactttacaaagactgtgatgaaaaatggagtcattacg
tttaaagcacagtctgaatgcgatattgttaacacgctttctagttatgcttttaaagca
ccagaggagataaaatcggttaacgatgaatgcatggagtatgatgccatggagaaagga
gaaaactga

DBGET integrated database retrieval system