KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1213cHelp
Entry
Spy49_1213c       CDS       T00780                                 

Definition
(GenBank) ATP-dependent RNA helicase SrmB, putative
  KO
K07012  CRISPR-associated endonuclease/helicase Cas3 [EC:3.1.-.- 3.6.4.-]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
KEGG Orthology (KO) [BR:soz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:soz02048]
    Spy49_1213c
Enzymes [BR:soz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Spy49_1213c
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Spy49_1213c
Prokaryotic defense system [BR:soz02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Type I signiture cas proteins
    Spy49_1213c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII DEAD HD Helicase_C PhoH AAA_22
Motif
Other DBs
NCBI-ProteinID: ACI61501
UniProt: A0A0H3C0T0
Position
complement(1207708..1210110)
Genome map
AA seq 800 aa AA seqDB search
MILAHYDCKKDKKQSLDEHLWHVACSSRQEASIIGQGDVLFLIGLYHDLGKADRTFQDKL
LNNPNRHVDHSYAGAKYLCSIIGPHLKNRGVDKNERMTFNEMVGYVISAHHGMYDLCYYF
DDAEYYGFNKFKNRINRDLDGYHYHEDIKGYALKLEKKLCDYGYKDLRELIDKAFDNYQQ
SMSSLNWQDKSEWDYYQSCMVRLYLSLLKNADILDTVNVYGLKISPMDKTERSFLKHSYL
AAIEQKYASFGQPNNQLNTIRTEIAERVKERGKRDSKGIYRLDLPTGAGKTNLSMRYAFH
QLVHHDKSRFFYITPFLSVLEQNAYEIRKVTGDLGVLEHHSNVVKQANEDDDDKDSLLSA
YLSDSWDSQVVLTSMVQFFQTLFKTKSANLRRFSSLINSVVILDEVQSLPIEVTTLFNLT
MNFLNKVMDTTIVLCTATQPAYDSSEIDHRICYGGNLGELAEIVELTIEEKQIFSRTELR
KFDDSDQKVHLTDVINLILGEENSVLAIFNTKKTVHNCYTMLKDMTDRPVYQLSTNMCAQ
HRLDLIAKIKTELQNNIPIICISTQLIEAGVDVDFHRVIRSYSGIDSIIQAAGRCNREGK
RDKGQVTLVNLTNEEENISRLTEIKAKKEATESILHKIGSPIDILTLNRDFFEYYYANNQ
GLMDYPLEDNLSIYDYLSLNIYQTANKKFKGKLKQAFKTAGAKMNLINNDMIGILVPYGE
AEKKLAYLEELGMSHFLSAEDYQTIKSLLKELQPFTVNVRENDPLFETTKSYLNGQILVL
TSEYYDTERGVKYDSASFYF
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgattttagcacactatgactgtaaaaaagataaaaagcaatctttagatgagcattta
tggcatgtggcctgttctagtcgacaggaagcatctataattggtcaaggagatgtgctt
tttttaattggtctttaccacgacctgggcaaagctgatcgaacctttcaagataaatta
ttaaataatccaaatcggcatgttgatcactcttatgcaggggcaaaatacttatgttct
attattgggcctcatctaaaaaaccgaggggttgataaaaatgagagaatgacattcaac
gaaatggtggggtatgtcatctctgctcatcatgggatgtatgatttatgctactatttt
gacgatgctgaatattatggctttaataagtttaaaaatcgtatcaatagagacttagat
ggttatcactatcatgaagatattaaagggtacgctctaaaattagaaaaaaaattatgt
gattatggctacaaagatttaagggagcttattgataaagcttttgataattaccaacaa
tccatgtcttccttaaactggcaagataagagtgagtgggattattatcagtcttgtatg
gtgagactttacttgtcactcttaaaaaacgctgatattttggacacagtaaatgtctat
ggccttaagataagtcctatggataaaacagagcgatcctttctaaaacactcctattta
gcggccattgaacaaaaatatgctagctttggacagccaaacaatcagttgaacactatt
cggacagaaatcgctgagcgtgttaaagaaagaggtaaacgagattccaaggggatttat
cgcttagatttaccgacaggagctggcaagactaatcttagtatgcgttatgcgtttcac
caattagttcatcacgacaaatcaaggtttttttacataacgccctttctttcggttctt
gagcaaaatgcttacgaaattagaaaagttacaggtgaccttggcgttctagaacaccat
tccaatgtggtgaaacaggctaatgaagatgatgatgacaaggacagtttattgtcagct
tatcttagtgatagctgggacagtcaagtagtcttgacttctatggttcaatttttccaa
acacttttcaaaacaaaatcagctaatctgagacgtttttcaagtttgattaatagtgtt
gtgattctagatgaagttcaatccctgcctattgaagtcaccactttgtttaatttaacg
atgaattttttaaataaagttatggatacaaccatcgttctttgcacagcaacacaacct
gcttatgattcttcagagattgaccatcgtatctgttatggagggaacttgggagaatta
gctgaaatcgttgagttaacgattgaagaaaaacagattttttcaaggacagagcttaga
aaatttgatgatagtgatcagaaagttcacttgactgatgttattaaccttattctaggt
gaggaaaactcagttcttgctatttttaatacgaaaaaaacggttcataactgctatact
atgctaaaagacatgactgatagaccggtctatcagctttcgacaaatatgtgtgcgcag
catagacttgacttgattgctaagatcaaaacggagttacaaaataatatccctattatt
tgtattagcacgcaattaattgaagcaggtgtagatgttgattttcatcgcgtcattcgt
tcctactcagggattgattctattattcaggctgctggacggtgtaaccgagaaggcaaa
cgagataaagggcaagtcactcttgtcaatctgaccaatgaagaggaaaatatttctagg
ctgacagaaataaaagctaaaaaagaagccacagaatctattcttcataagattgggtct
ccaattgatatcttaactttaaaccgtgacttttttgagtattattatgccaataatcag
ggactgatggattatcctttggaagacaacctatcaatctacgactatttaagccttaat
atttatcagacggcaaataaaaagttcaaaggtaagttaaaacaagcttttaaaacagca
ggagccaaaatgaacctcatcaataatgatatgataggaattctcgtaccttatggcgaa
gctgagaaaaaattggcttatttagaagaattgggtatgtctcactttttatcagcagaa
gattatcaaacgataaaatcattactaaaagagttacaaccttttacggttaatgtccgc
gagaacgatcctctctttgagacaacaaaatcttatctaaatggtcagattctggttttg
acgtcggagtattatgacacggaaagaggagttaaatacgattcagctagcttttacttc
taa

DBGET integrated database retrieval system