KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1219cHelp
Entry
Spy49_1219c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1912
Motif
Other DBs
NCBI-ProteinID: ACI61506
UniProt: A0A0H3C0T3
Structure
PDB: 

Position
complement(1214499..1214753)
Genome map
AA seq 84 aa AA seqDB search
MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVAQEDGDERAKDAFIRYESKLDAYEFLLG
KFDNYKNGKAFHDIPDELFGARHY
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatgaaaaagaatttttaaaagattttgaagactgggttaaaactcagattcaa
gtcaatcagctagccatggcaaccagtcaagaagttgcccaagaagatggcgatgaaagg
gctaaagatgcctttattcgttatgaaagtaagttagacgcctacgaatttttactaggt
aaatttgacaattataaaaatggtaaagcctttcacgatattccagatgagttatttgga
gcaaggcattattaa

DBGET integrated database retrieval system