KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1220Help
Entry
Spy49_1220        CDS       T00780                                 

Gene name
aroA2
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
soz01100  Metabolic pathways
soz01110  Biosynthesis of secondary metabolites
soz01130  Biosynthesis of antibiotics
soz01230  Biosynthesis of amino acids
Module
soz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:soz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spy49_1220 (aroA2)
Enzymes [BR:soz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Spy49_1220 (aroA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: ACI61507
UniProt: A0A0H3C1F2
Position
1215231..1215983
Genome map
AA seq 250 aa AA seqDB search
MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASF
QGLGLQGIRYLHEVCQEFGLLSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSH
IDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGVRGYDVETRNMLDIMAVPIIQ
QKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL
EQLGQELWQD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgattgacattatgtctgactttcaaaataagacttgttctaagaataattttattgtt
ggaccttgttccattgaatcttatgatcacattagattagcagcttcaagtgccaaaaaa
cttggttataactattttagaggaggcgcctataaaccaagaacatctgctgcttctttt
caaggccttggtctgcaaggaattcgttacttgcatgaggtttgtcaggaatttggctta
ctatcggtcagtgaaatcatgtccgagcgccaattagaagaagcctatgactatctcgat
gtcattcaggttggtgcccgcaacatgcaaaattttgaatttttaaaaaccttgtcacac
atcgataagcctattttgtttaaacgaggcttgatggctactatcgaggaatatttgggc
gccctttcctacttacaagacactggaaaatctaacattatcttatgcgaacgtggcgtt
cgtggctacgatgtggagactagaaatatgcttgatattatggcagtccctattattcaa
caaaagacagatttaccgattattgtggacgtgtctcattcgacaggcagacgagattta
ctcttacctgctgctaagatagcgaaggctgtcggtgccaatggcatcatgatggaggtt
catcctgatcccgaccatgcgctgtcagatgctgcccagcaaattgattataagcaatta
gaacagttggggcaggaactttggcaagattaa

DBGET integrated database retrieval system