KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1229cHelp
Entry
Spy49_1229c       CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF624
Motif
Other DBs
NCBI-ProteinID: ACI61516
UniProt: A0A0H3BZ55
Position
complement(1226886..1227491)
Genome map
AA seq 201 aa AA seqDB search
MNGIEKTCFLIWKMIQLTLIFHLLSLAGLIVFGVGPAWQTIVTLFLKTSQEENHYSLKRA
VQLWKSYFKEANLRFGLFALTFLFLTFNLHWAVQFPSLFWFTVSFLIVIAMVWLTMTYLY
MVFYAVSYEISLWNNMKLAFISVFLSFKSFLLMLSVLLGITLVTWQYKGLYLFLTFGALV
FCLDFVTKANRRLVDGVIDEC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcattgaaaaaacctgctttttaatttggaaaatgatccaattgaccctcatt
tttcatctcttgtccttagctggactgattgtatttggggtggggccagcctggcaaacc
attgtcaccctatttttaaaaacatctcaagaagaaaaccactattctttgaaaagggct
gttcaactttggaaatcttatttcaaagaagctaatctaagatttggtctttttgccctg
actttcctttttttaacctttaatttgcattgggcagtacagtttccatccttgttttgg
tttaccgtgtctttcttgattgtaatagccatggtttggctaaccatgacctatctttac
atggttttttatgcagtgagctatgagattagcctttggaataatatgaaattagccttt
atcagcgtctttttaagtttcaaatcctttttactcatgctgagtgttttgctgggaatt
accttagtgacttggcaatacaaaggcctttatctctttttaaccttcggagctctagtc
ttttgcttggactttgtcactaaggctaatcgtcgactagtagatggagtgattgatgag
tgttaa

DBGET integrated database retrieval system