KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1239Help
Entry
Spy49_1239        CDS       T00780                                 

Definition
(GenBank) Alpha-mannosidase
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:soz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spy49_1239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:soz04131]
    Spy49_1239
Enzymes [BR:soz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     Spy49_1239
Membrane trafficking [BR:soz04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    Spy49_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_38 Glyco_hydro_38C Alpha-mann_mid
Motif
Other DBs
NCBI-ProteinID: ACI61525
UniProt: A0A0H3BY40
Structure
PDB: 

Position
1238578..1241283
Genome map
AA seq 901 aa AA seqDB search
MATKKVHIISHSHWDREWYMAYEQHHMRLINLIDDLLEVFQTDPDFHSFHLDGQTIILDD
YLKVRPEREPEIRQAIASGKLRIGPFYILQDDFLTSSESNVRNMLIGKEDCDRWGASVPL
GYFPDTFGNMGQTPQLMLKAGLQAAAFGRGIRPTGFNNQVDTSEKYSSQFSEISWQGPDN
SRILGLLFANWYSNGNEIPTTEAEARLFWDKKLADAERFASTKHLLMMNGCDHQPVQLDV
TKAIALANQLYPDYEFVHSCFEDYLADLADDLPENLSTVQGEITSQETDGWYTLANTASA
RIYLKQANTRVSRQLENITEPLAAMAYEVTSTYPHDQLRYAWKTLMQNHPHDSICGCSVD
SVHREMMTRFEKAYEVGHYLAKEAAKQIADAIDTRDFPMDSQLFVLFNTSGHSKTSVAEL
SLTWKKYHFGQRFPKEVYQEAQEYLARLSQSFQIIDTSGQVRPEAEILGTSIAFDYDLPK
RSFREPYFAIKVRLRLPITLPAMSWKTLALKLGNETTPSETVSLYDDSNQCLENGFLKVM
IQTDGRLTITDKQSGLIYQDLLRFEDCGDIGNEYISRQPNHDQPFYADQGTTKLNIISNT
AQVAELEIQQTFAIPVSADKLLQAEMEAVIDITERQARRSQEKAELTLTTLIRMEKNNPR
LQFTTSFDNQMTNHRLRVLFPTHLKTDHHLADSIFETVKRPNHPNAAFWKNPSNPQHQEC
FVSLFDGEKGVTIGNYGLNEYEILPDSNTIAITLLRSVGEMGDWGYFPTPEAQCLGQHSL
SYSFESIDRQTQFASYWRAQEGQVPILVEQTSHHTGSLRAEHSYVTGADDQVALTAFKRR
LADNALITRSYNLSNDKTCDFSLSLPNYNAKVTNLLEKDSKQSTPSQLGKAEILTLAWKK
Q
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagtacatattatttcacacagtcactgggatcgcgagtggtacatg
gcttacgaacaacaccacatgcgtctgattaacttaatagatgacctgttagaagttttt
caaacggatcctgattttcatagttttcatttggatgggcaaaccattatcctagatgat
tatttaaaagtacgccccgaacgagaacctgagattagacaagccattgcttcgggaaaa
ctccgtatcggacctttctatatcttacaggacgattttttgaccagcagtgaatccaat
gtgcgcaatatgctgattggtaaggaagattgtgacagatggggcgctagtgtgccactt
ggttattttcctgatacctttggaaatatggggcaaacaccacagctgatgttaaaagcc
ggcctacaagctgctgcctttggtcgtggcattcgtccaactggatttaacaatcaggtg
gataccagtgaaaaatacagctcccaattctctgaaatcagttggcaaggcccagataac
agtcgtattcttggactcctcttcgccaactggtacagcaatggcaatgagatcccgaca
acagaagctgaggcgcgtcttttttgggataaaaaacttgctgacgctgaacgctttgcc
tcaaccaagcaccttctgatgatgaacgggtgtgatcatcaacccgtacaacttgatgtc
accaaggcaatcgccttagccaaccaactctatcctgactacgaatttgtgcattcctgc
tttgaagattacttggctgatctcgcagatgatttaccagagaacctttcaaccgtccaa
ggagagattaccagtcaagaaaccgatggctggtataccctagctaacacggcttctgct
cgtatttacctcaaacaggctaataccagagtctctcgccaactcgaaaacatcaccgaa
cccttagcagcaatggcttatgaggtaacaagtacctaccctcacgaccaactgcgttac
gcttggaaaaccctcatgcaaaatcaccctcatgattctatctgtggttgtagtgttgat
agcgttcatcgggaaatgatgacgcgctttgaaaaagcctatgaagtcggacactattta
gcaaaagaagctgctaagcaaattgctgacgccattgataccagggattttccaatggat
agccaactcttcgtcttatttaataccagcggccattccaaaacaagtgttgctgagctc
agcctgacctggaaaaaatatcattttggccaacgctttcctaaagaggtttaccaagaa
gctcaagaatatttggcaagactctcccaatctttccaaattattgacactagtggacaa
gtgagacccgaagcagaaattttaggcacaagcatcgcttttgactacgatttgcccaag
agatccttccgcgaaccttatttcgccatcaaagtgagattacggctaccaataactctc
ccagccatgtcttggaaaaccttagcattaaagctaggaaatgaaacaactccttcagaa
accgtttccctctacgatgacagtaatcagtgccttgaaaatgggtttctaaaagttatg
atacaaaccgatggtcgtctaaccatcaccgataaacaatctggactaatctatcaagac
ctgttgcggtttgaagattgtggcgatattggaaatgaatatatttctcgccaaccaaat
catgaccaacctttctatgcggaccaagggaccaccaagcttaacatcattagcaacacc
gctcaagttgctgaacttgaaatccagcaaacctttgccattcctgtctccgcagataag
ctcttacaggctgaaatggaggctgtcattgacatcacagaacgccaagcaagacgttca
caagaaaaagctgagctaaccttaacaacccttatccgcatggagaaaaacaatcctcgc
ctccaattcaccacaagttttgataaccaaatgactaatcatcgcttgcgcgtcctattc
ccaacgcaccttaagacagaccatcacctagctgatagtatttttgaaactgtcaaacgt
ccaaatcatccaaatgctgccttttggaagaatccaagtaacccacagcaccaagaatgc
tttgtgagtctctttgatggtgaaaagggggtcactattggtaactacggcctcaacgaa
tatgagattttaccagatagcaacaccattgccatcactctcttacgttctgttggtgag
atgggggactggggttacttcccaacacctgaagcccagtgtcttggccagcatagccta
tcttatagttttgaaagcatcgataggcaaacacaatttgccagctattggcgggcacaa
gaaggccaagttcctatcctagtcgaacaaaccagccatcatacgggaagcttaagagca
gagcatagctatgtcactggtgcagacgatcaagtcgctctaacagctttcaaacgtcgc
ttagcagacaatgcccttatcacgcgcagctataatctctcaaacgataaaacttgtgac
tttagcctaagcctgccaaactacaatgccaaggtcactaatttgttagaaaaagacagc
aagcaaagcacacccagccaacttggcaaagcggaaattttaactctagcttggaagaaa
caataa

DBGET integrated database retrieval system