KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1243Help
Entry
Spy49_1243        CDS       T00780                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K07586  uncharacterized protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
KEGG Orthology (KO) [BR:soz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Spy49_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF402 DUF354
Motif
Other DBs
NCBI-ProteinID: ACI61529
UniProt: B5XMG7
Position
1245731..1246264
Genome map
AA seq 177 aa AA seqDB search
MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREP
AIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLD
VDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacctaaagaaggcgactttattacaattcaaagttataagcatgatggtagt
ttgcaccgtacttggcgcgatactatggtactaaaaacaactgaaaatgccctcattgga
gttaatgatcacactcttgtcacagaaagtgacggtagacgatgggtgacccgcgaacct
gcaatcgtttactttcataaaaaatactggtttaacattatagccatgattcgagataat
ggcgtctcttattactgtaacttagctagtccatacatgatggacactgaggcccttaaa
tacattgattacgatttagatgtcaaagtctttgcggatggtgaaaagagattacttgat
gttgatgaatacgagattcataaaaaagagatgcagtattcagccgatatggactttatc
ctaaaagaaaatgtcaaaatattggttgattggattaatcatgaaaaaggaccattttcc
aaggcctatatcactatttggtacaaacgttatcttgaactgaagaatcgttaa

DBGET integrated database retrieval system