KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1244Help
Entry
Spy49_1244        CDS       T00780                                 

Definition
(GenBank) hypothetical protein
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI61530
UniProt: A0A0H3C0V6
Position
1246634..1246912
Genome map
AA seq 92 aa AA seqDB search
MALDVVIKTDKTPLLGRILSKYIGRLTSCIENETTKIRNHSRQNDTIGLNHLLGNLKTVH
NPEIILKAINVYSRRLQVFSQIMATLILGLIL
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
ttggcacttgatgttgtaatcaaaactgacaagacacctcttttaggtagaattttatca
aagtatataggacgcttgacgtcgtgtattgaaaatgaaaccactaaaataaggaatcat
tcaagacaaaacgataccatcggcctcaatcatcttcttggaaacttgaaaaccgtccat
aaccctgagattatccttaaagcgattaatgtctattctcgtcgtcttcaggttttttcg
cagataatggctacgcttatactcggtttaatcctttag

DBGET integrated database retrieval system