KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1252cHelp
Entry
Spy49_1252c       CDS       T00780                                 

Definition
(GenBank) Putative polyribonucleotide nucleotidyltransferase
  KO
K07570  general stress protein 13
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1 BPL_C
Motif
Other DBs
NCBI-ProteinID: ACI61537
UniProt: A0A0H3BY51
Position
complement(1258365..1258742)
Genome map
AA seq 125 aa AA seqDB search
MKIGDKLHGTITGIKPYGAFVALDNGTTGLIHISEIKTGFIDDIDQLLAIGNQVLVQVID
IDEYSKKPSLSMRTLAEEKQHFFHRHRYSNSRHKIGFRPLEEQLPQWIEESLQFLKKNTK
KSLEP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcgacaaactgcatggcaccatcactgggattaaaccatacggagccttt
gttgcccttgacaatgggacaacaggtctcattcatatttcagaaataaaaacgggattt
attgacgatattgatcaattattggctataggcaaccaggttttagtacaagtaattgat
attgatgaatatagtaaaaagccaagtttatctatgcggaccttagcagaagaaaaacag
cattttttccatcgtcatcgttattccaacagtcggcacaagattggctttaggccactt
gaagagcagttacctcagtggattgaagaaagcctgcagtttttaaaaaagaacactaaa
aagagtctggaaccttag

DBGET integrated database retrieval system