KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1268Help
Entry
Spy49_1268        CDS       T00780                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00071  Fatty acid degradation
soz00072  Synthesis and degradation of ketone bodies
soz00280  Valine, leucine and isoleucine degradation
soz00310  Lysine degradation
soz00362  Benzoate degradation
soz00380  Tryptophan metabolism
soz00620  Pyruvate metabolism
soz00630  Glyoxylate and dicarboxylate metabolism
soz00640  Propanoate metabolism
soz00650  Butanoate metabolism
soz00900  Terpenoid backbone biosynthesis
soz01100  Metabolic pathways
soz01110  Biosynthesis of secondary metabolites
soz01120  Microbial metabolism in diverse environments
soz01130  Biosynthesis of antibiotics
soz01200  Carbon metabolism
soz01212  Fatty acid metabolism
soz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:soz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spy49_1268 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Spy49_1268 (atoB)
   00640 Propanoate metabolism
    Spy49_1268 (atoB)
   00650 Butanoate metabolism
    Spy49_1268 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Spy49_1268 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Spy49_1268 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spy49_1268 (atoB)
   00310 Lysine degradation
    Spy49_1268 (atoB)
   00380 Tryptophan metabolism
    Spy49_1268 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spy49_1268 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spy49_1268 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Spy49_1268 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soz04147]
    Spy49_1268 (atoB)
Enzymes [BR:soz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Spy49_1268 (atoB)
Exosome [BR:soz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spy49_1268 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACI61551
UniProt: A0A0H3BZR3
Position
1273972..1275159
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLSDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAARALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagacatggtttgcggttctggacttaaagcaatccaattagctgcgcaa
agcatcatgcttagtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacaa
gcagcttatgtctcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctagggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system